Details for Lyrate rockcress Locus 16035263

Position : sca3 ( 5`- 1476633 .. 1475562 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035263

Protein [Map View]
MGRLKFACPVLEINLISAQDLAPVSRNMKTYSVAWINTDPMRKLTTRVDQSNRANPIWNEKFVFRVNDKILDVDASAIVI
EIYAAAWAKDALVGTVNVLLSDLFAPWSGFGDGDDGGGGNNNMRLVTLQIRRPSGRLQGFLRLGVALLDGGQRSMPLSIE
VFDGSRRGETNSNKRDQEASRMMHRRTNSDQTDLTTSTNDYGVKTGVVTGNGGGGGGGGGIVVGADSMVNGSLCSSDIGP
SASVVAAAIAQGLYNRQKTAVKAASSNKEDASSILEGKTEGIEHRVERWRAEKNGTAGAGEAAGSSDDSSGKGGAGRRRR
RRRRRKEKQQGRRNGGGEGKKGLFSCFGNVFGCEISI

DNA
ATGGGTCGGCTCAAGTTCGCATGTCCCGTTCTTGAGATCAATCTAATCTCAGCTCAAGATTTAGCCCCTGTTTCAAGAAA
CATGAAAACGTATTCCGTCGCTTGGATCAACACCGATCCTATGAGAAAACTCACTACGCGTGTTGATCAATCCAATAGAG
CTAACCCTATATGGAACGAGAAGTTTGTGTTTCGTGTTAACGACAAGATTCTTGACGTTGACGCATCAGCGATTGTGATT
GAGATTTACGCAGCGGCTTGGGCTAAAGATGCTCTTGTTGGTACTGTGAATGTTCTTCTTAGCGATCTTTTTGCTCCTTG
GTCTGGTTTTGGTGATGGTGACGATGGTGGTGGTGGGAATAATAATATGAGGCTTGTGACGCTTCAGATTCGTCGTCCTT
CAGGGAGGCTTCAAGGGTTTTTACGGCTAGGTGTTGCTCTTCTCGACGGTGGTCAACGGAGTATGCCGTTATCTATCGAG
GTTTTCGATGGAAGTCGAAGAGGAGAGACGAATAGTAATAAAAGAGATCAAGAAGCTTCAAGGATGATGCATCGCCGTAC
GAATAGCGATCAAACGGATTTAACCACGTCTACGAATGATTATGGTGTGAAAACAGGGGTTGTTACTGGCAATGGAGGAG
GAGGAGGTGGTGGTGGTGGTATTGTTGTTGGTGCGGATAGTATGGTTAATGGTTCACTTTGTAGCTCTGATATTGGACCA
TCAGCGTCTGTGGTTGCGGCTGCGATTGCTCAGGGGCTTTACAATAGGCAGAAAACAGCGGTTAAAGCCGCGAGTAGTAA
CAAAGAGGACGCAAGTTCGATACTTGAAGGGAAAACAGAGGGAATTGAGCATAGAGTTGAACGGTGGAGAGCAGAGAAAA
ATGGCACGGCTGGAGCGGGTGAAGCGGCTGGATCGAGCGATGATTCTAGCGGGAAAGGAGGGGCTGGAAGGAGAAGAAGG
AGAAGAAGAAGAAGAAAGGAGAAACAACAAGGGCGGAGAAACGGTGGAGGAGAGGGTAAGAAAGGGTTGTTTTCATGTTT
TGGAAACGTGTTTGGATGTGAGATTTCGATAA