Details for Lyrate rockcress Locus 16035223

Position : sca3 ( 5`- 505217 .. 503888 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035223

Protein [Map View]
MGSRQGPPKHQNKFAWVPKAGVKINETEVGGRFRPLSEITGVCYRCREQIAWKRKYGKYKTLTEATKCQKCTKRNVRQAY
HKLCPGCAKEQKVCAKCCSRVDQILGRDIYEVEAEQKMLDETIKNARERDRRTLLRAMNKDNKPNKSDEEATRSDSSKVG
DVFPSTSLEEYANKSGRVSGIIGHGSVPDHGHDDDDASGPESDEDHNGGDDEHDLREDSDANEPSQL*

DNA
ATGGGCTCACGGCAGGGACCACCGAAGCATCAGAACAAATTCGCCTGGGTTCCTAAAGCCGGCGTCAAGATCAACGAAAC
GGAAGTCGGCGGGAGATTTAGACCATTATCAGAGATTACCGGAGTTTGTTATCGATGTCGAGAGCAGATCGCTTGGAAAC
GCAAATACGGCAAATACAAAACCCTAACTGAAGCCACCAAATGTCAGAAGTGTACTAAGCGAAATGTTCGTCAAGCATAC
CATAAGTTATGCCCTGGTTGTGCCAAGGAGCAGAAGGTGTGTGCAAAGTGTTGTTCACGTGTTGATCAAATCCTTGGAAG
AGATATTTACGAGGTTGAAGCTGAGCAGAAGATGCTTGATGAGACTATCAAGAATGCTAGGGAAAGGGATCGAAGGACGC
TATTACGCGCTATGAACAAAGATAACAAACCGAACAAATCAGATGAAGAAGCGACAAGGAGTGATAGCAGCAAGGTTGGT
GATGTGTTTCCCTCAACTTCCCTTGAAGAATATGCAAACAAGTCAGGAAGAGTTAGCGGGATTATTGGTCATGGTAGTGT
ACCTGATCATGGCCATGATGATGATGATGCTAGTGGACCTGAATCAGATGAGGATCACAATGGTGGTGATGATGAGCATG
ATTTGCGCGAAGACAGTGATGCAAATGAGCCATCTCAACTGTAG