Details for Lyrate rockcress Locus 16035217

Position : sca3 ( 5`- 5576171 .. 5578740 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035217

Protein [Map View]
MGSRGNRVGDRWNEMDCDEKTSVIQEEIKRVGKLPSNSVYAVHRLKVLNKINDLLSVQRTLSQEKDFVVIVIIFIREKSK
TLLHHHPYIKSPNPYHTEEKLKPKSKKMRNVMENIKSKRDVIVCRGIWYAMTLLSLFGLSISLNLLWPPGDSSSTSRFLR
DGAVSATTFYAVTLLRYLFFTHPPSTCYTEFTAPKERIPQVVFSELALYLVFTTPLQCSLLFTNNVLSLLYISLFIISLF
TGGIGLIQLSEKCRMETRHALITLFFGWLFGLFGIFEALYCNDYNGVALFLANLYVMFSLGLFLYNFPLRRTCILCLLLP
FLFNPKRKSLSEYTYILSN*

DNA
ATGGGAAGCAGAGGTAATCGTGTGGGAGATAGATGGAATGAGATGGATTGTGATGAGAAAACGAGTGTGATTCAGGAAGA
GATCAAAAGGGTTGGTAAATTGCCATCAAACAGTGTTTATGCAGTTCATCGTCTCAAGGTTCTCAACAAAATCAACGACC
TTTTATCTGTCCAAAGAACATTGTCCCAAGAGAAGGATTTTGTTGTGATTGTGATAATCTTTATACGCGAAAAGTCAAAA
ACCCTACTTCATCATCATCCCTATATTAAGTCTCCGAACCCCTACCACACTGAGGAGAAGCTAAAACCTAAAAGTAAGAA
GATGAGAAACGTAATGGAGAACATAAAGAGTAAAAGAGATGTTATTGTATGCAGAGGAATATGGTATGCCATGACTCTAC
TCTCGCTCTTTGGCCTCTCCATATCCCTCAACCTTCTCTGGCCACCTGGTGACTCGTCATCGACGTCTCGGTTCCTAAGA
GACGGTGCGGTCAGTGCCACAACATTCTACGCAGTGACGCTACTCAGATATCTCTTTTTCACCCATCCTCCCTCCACTTG
CTACACGGAGTTTACTGCACCTAAAGAGAGGATTCCTCAGGTTGTGTTCTCGGAGCTTGCCTTGTACCTAGTGTTCACAA
CGCCGCTACAATGTTCACTCTTGTTTACGAACAACGTGTTGTCTTTGTTATACATATCGTTATTCATCATATCATTGTTC
ACCGGAGGGATAGGGCTTATTCAGCTATCAGAAAAGTGTAGGATGGAGACGAGACATGCTTTGATCACACTTTTCTTCGG
TTGGTTGTTTGGTCTTTTTGGCATCTTTGAAGCTTTATACTGCAACGACTATAACGGAGTGGCGTTGTTCCTTGCCAATC
TTTATGTAATGTTTTCCCTTGGGCTCTTTTTGTATAATTTCCCCTTGAGAAGGACTTGCATACTTTGCCTGCTTCTCCCC
TTCCTATTTAATCCAAAGAGGAAAAGCTTATCTGAGTACACATACATTCTTTCTAATTAA