Details for Lyrate rockcress Locus 16035190

Position : sca3 ( 5`- 657223 .. 654356 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477488 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035190

Protein [Map View]
MKIFVKTLKGTHFEIEVKLEDSVADVKKNIETVQGADVYPAAKQMLIHQGKVLKDETTIEENKVAENSFIVVMLNKSKPA
STGASSASAGTSQAKSTPPSTSQPSISPQTPASVAAPVAPAPTRAPPPAPTPAPVAATETVTTPIPEPVPATIPSSTPAP
DSAPAGSQGDVYGQAASNLAAGSNLESTIQQILDMGGGTWDRETVVRALRAAFNNPERAVEYLYTGIPEQAEVPPVARAP
ASFGQPANPSAQTQQPAAAPASGPNANPLDLFPQGLPNVGGNPGAGTLDFLRNSQQFQALRAMVQANPQVLQPMLQELGK
QNPNLMRLIQDHQADFLRLINEPVEGGGESGNLLGQMAAGMPQPQAIQVTPEEREAIERLEAMGFDRALVLEVFFACNKN
EELAANYLLDHMHEFEE*

DNA
ATGAAGATATTTGTGAAAACTCTCAAGGGGACTCACTTTGAGATCGAAGTAAAACTAGAGGATTCGGTTGCTGATGTGAA
GAAGAACATAGAGACTGTGCAGGGCGCAGATGTATATCCTGCTGCAAAACAGATGCTTATTCACCAAGGTAAAGTGCTTA
AAGATGAGACTACTATTGAGGAAAACAAAGTTGCTGAGAACAGTTTTATTGTCGTAATGCTGAACAAGAGTAAACCTGCT
TCTACTGGAGCATCTAGTGCATCTGCTGGCACTTCGCAGGCCAAGTCGACACCTCCCTCAACATCACAACCTTCAATTTC
CCCTCAGACTCCAGCTTCTGTAGCAGCACCAGTGGCACCTGCACCGACACGTGCGCCACCACCTGCCCCGACACCTGCAC
CTGTAGCTGCAACTGAAACTGTGACTACACCTATACCTGAACCTGTACCTGCTACTATACCATCAAGCACTCCTGCACCA
GACTCAGCTCCTGCGGGAAGTCAAGGTGATGTTTACGGACAAGCAGCATCAAATCTAGCCGCTGGAAGTAATTTAGAGAG
TACCATTCAGCAGATTCTTGACATGGGTGGAGGAACCTGGGATCGTGAGACTGTTGTCCGTGCACTTCGTGCTGCATTTA
ACAACCCCGAAAGAGCTGTGGAATATCTTTATACTGGGATCCCTGAGCAAGCTGAAGTTCCACCAGTTGCCCGTGCTCCA
GCTAGTTTTGGACAGCCTGCAAATCCTTCAGCACAGACTCAACAACCTGCAGCAGCACCTGCAAGTGGTCCTAATGCAAA
TCCGTTAGATCTCTTCCCGCAGGGCTTGCCAAATGTTGGAGGAAATCCTGGTGCTGGAACACTTGACTTCTTGCGCAACA
GCCAACAGTTCCAAGCTCTGCGAGCAATGGTGCAAGCAAACCCTCAAGTTCTGCAGCCCATGCTTCAGGAACTGGGAAAG
CAGAACCCAAACTTGATGCGGTTGATTCAAGACCACCAAGCTGACTTCTTACGCTTAATCAATGAACCCGTTGAAGGAGG
GGGAGAAAGTGGCAACCTCCTTGGCCAAATGGCAGCGGGAATGCCACAGCCACAGGCGATTCAAGTCACACCTGAGGAAC
GCGAAGCAATTGAACGGCTTGAAGCGATGGGATTTGACAGAGCATTGGTGTTGGAAGTGTTCTTTGCGTGCAACAAGAAT
GAAGAGTTGGCTGCAAACTATCTTCTAGATCACATGCATGAGTTCGAGGAATAA