Details for Lyrate rockcress Locus 16035156

Position : sca2 ( 5`- 16585694 .. 16583904 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035156

Protein [Map View]
MVEPYETRNNGKASQMVRYQSYNHHNSRLPSPLSSPLLDLRVFYVRISNFKVDHSTPEVLTITHIPLDPDSLLEINGVRM
SMYSEGVSSQLRRDRVDKKSEVATFISTDNIRLSGSVKFEVYDKDELVLSGTLEMSGSNGFTGEPKYSVKRWNMKCEAEI
TAGSGFLKEKHIGGSELSSPLPTIEVYVTGCFSGTPIILTKTLQLGFRKKHGRVAALDSIPEYEADEPHKGNSSELDYQV
TEYGSYKQEYEGEHSDMYWNREYADGEDGEMSWFNAGVRVGVGIGLGVCVGLGIGVGLLVRTYQSTTRNFRRRII*

DNA
ATGGTGGAGCCTTATGAGACACGTAACAACGGTAAAGCTTCCCAGATGGTCAGATATCAGAGTTATAACCATCACAATTC
CAGATTACCATCACCATTATCATCGCCATTACTTGATTTGAGAGTGTTCTATGTCAGAATCAGCAATTTCAAGGTGGATC
ATTCAACACCTGAGGTCCTCACCATTACTCATATTCCTTTGGATCCAGATTCACTTCTGGAGATAAATGGTGTTAGAATG
AGCATGTACTCTGAAGGAGTTTCTTCTCAGCTAAGGCGAGATCGTGTTGATAAGAAATCCGAAGTAGCTACTTTTATCAG
CACAGACAATATCAGGTTATCTGGTAGCGTGAAGTTTGAGGTTTATGACAAAGATGAGCTGGTTTTGTCTGGAACTCTTG
AGATGTCTGGTAGTAATGGTTTCACTGGTGAACCTAAGTATAGCGTGAAGCGGTGGAACATGAAATGTGAAGCTGAGATC
ACTGCAGGGTCTGGTTTCTTGAAGGAGAAACATATTGGTGGGTCGGAGTTATCATCTCCATTGCCAACTATTGAAGTCTA
TGTCACTGGCTGCTTTTCAGGAACTCCCATCATCTTAACCAAGACTCTTCAGCTTGGTTTCAGAAAGAAGCACGGTAGAG
TGGCTGCATTAGATTCGATTCCGGAGTATGAAGCTGATGAGCCTCATAAAGGAAACTCATCTGAGCTTGATTATCAGGTA
ACAGAATATGGAAGTTATAAACAAGAATATGAAGGCGAACACAGCGACATGTATTGGAATAGAGAGTACGCAGATGGTGA
AGATGGTGAGATGTCGTGGTTCAACGCCGGTGTGAGGGTTGGTGTGGGAATTGGTCTTGGTGTCTGTGTAGGTCTTGGCA
TTGGGGTTGGCCTTCTAGTGCGTACCTATCAATCAACCACCAGAAACTTCAGAAGGAGGATTATCTAG