Details for Lyrate rockcress Locus 16035073

Position : sca3 ( 5`- 7508711 .. 7507966 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035073

Protein [Map View]
MEVSNSCSSFSSSSVDSTKPSPSESSVNLSLSLTFPSTSPQREARQDWPPIKSRLRDTLKGRRLLRRGDDTSLFVKVYME
GVPIGRKLDLCAFSGYESLLENLSHMFDTSIICGNRDRKHHVLTYEDKDGDWMMVGDIPWDMFLETVRRLKITRPERY*

DNA
ATGGAGGTTTCTAACTCTTGTTCTTCATTTTCTTCATCCTCTGTCGACAGTACTAAGCCTTCTCCTTCTGAATCTTCTGT
TAATCTCTCCCTTAGCCTCACTTTTCCTTCTACTTCTCCACAAAGAGAAGCAAGACAAGATTGGCCACCGATAAAGTCTC
GATTAAGAGATACACTAAAGGGTCGTCGCCTTCTTCGTCGTGGTGATGACACTTCTCTCTTTGTTAAGGTTTATATGGAA
GGTGTCCCCATTGGAAGAAAACTCGACCTTTGCGCATTCTCAGGCTACGAGAGCCTATTAGAAAATCTTTCTCACATGTT
TGATACTTCAATCATCTGCGGTAACCGAGATAGAAAACATCATGTTTTGACATATGAAGACAAGGATGGAGATTGGATGA
TGGTCGGGGATATTCCATGGGATATGTTTCTTGAAACCGTGAGAAGACTAAAGATCACGAGACCGGAGAGGTATTAA