Details for Lyrate rockcress Locus 16035050

Position : sca3 ( 5`- 625955 .. 625561 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035050

Protein [Map View]
MPTIISPYKNSFEQVSSQSNNSSSKSLICYTSIVISTGFLWTQLDMESIIMSLRRKEKKSQSRRLGKYLKEQKGRIYIIR
RCVMMLLCSCD*

DNA
ATGCCGACAATAATTTCTCCCTATAAAAACTCATTCGAACAAGTATCTTCCCAATCAAATAACTCATCTTCCAAATCTTT
AATTTGCTATACAAGCATTGTTATATCAACTGGTTTCTTATGGACACAACTGGATATGGAAAGCATCATCATGAGCTTGA
GGAGAAAGGAGAAGAAATCACAAAGTAGAAGACTCGGGAAATATCTCAAAGAACAAAAGGGGAGGATCTACATCATTAGA
AGATGTGTGATGATGCTTCTTTGTTCATGTGATTAA