Details for Lyrate rockcress Locus 16035048

Position : sca3 ( 5`- 674624 .. 672496 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477494 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16035048

Protein [Map View]
MEIATVVKANGGCEADRRRLRRLRCSVKDYDWGKIGSDSLVYRVYAANSDDQIDPTRPYAELWMGTHESGPSYLEDADGS
NGVTLRSWITENPKSLGDRVLEKWGCDLPFLFKVLSVARPLSIQAHPDKKLAKKMHKAHPNLYKDDNHKPEMALAYTQFE
ALCGFIPLQELKSVIQAIPEIEELVGSEEANQVFCISEHDEEKVKSVVRTIFTLLMSADPDTTKKIVSKLKRRLHMDSQE
RQLTDKERLVLKLEKQYPNDIGVISAFFFNYVKLNPGEALYLGANEPHAYLFGECLEVMATSDNVVRAGLTSKPLDIQTL
CSMLSYKLGYPEILKGSRIRPYITRYLPPFEEFEVDLCDLPSAASTVFPSVPGPSLLLVLQGEGRMSTEASADGISMGDV
LFVPADTEIHLRSSSDLKLYRAGINSRFLYPL*

DNA
ATGGAGATCGCTACTGTCGTTAAGGCTAATGGCGGTTGTGAAGCAGATCGACGACGGCTTCGTCGATTGAGATGCTCTGT
TAAGGATTACGATTGGGGCAAAATTGGATCGGATTCACTCGTTTACAGGGTTTATGCGGCTAACTCGGATGACCAGATCG
ATCCTACACGACCTTACGCCGAGCTTTGGATGGGGACTCACGAGTCCGGTCCGAGTTACTTGGAGGATGCTGATGGAAGC
AATGGCGTGACCCTTAGATCGTGGATCACCGAAAACCCTAAATCTCTTGGAGATAGGGTTTTGGAGAAATGGGGTTGCGA
TCTCCCATTTCTGTTCAAGGTGTTGTCCGTGGCAAGGCCCTTGTCGATTCAAGCACATCCGGACAAGAAATTAGCAAAGA
AAATGCACAAAGCTCATCCTAATCTTTATAAAGATGACAATCACAAACCAGAGATGGCTTTGGCCTATACTCAATTCGAG
GCTCTGTGTGGCTTTATACCTCTTCAGGAGCTTAAGAGTGTCATTCAAGCTATTCCGGAGATTGAGGAACTTGTTGGGAG
TGAAGAAGCAAACCAAGTTTTCTGCATCAGTGAACATGATGAGGAAAAAGTGAAATCTGTTGTCCGAACAATCTTCACCC
TGTTAATGTCTGCAGATCCCGATACAACAAAGAAAATAGTATCCAAACTAAAACGCCGTCTGCATATGGATAGTCAGGAA
CGTCAACTGACAGACAAGGAAAGGCTGGTTTTGAAGCTAGAGAAGCAATATCCAAATGATATTGGAGTCATATCTGCATT
CTTCTTCAACTATGTGAAGCTCAATCCTGGCGAAGCCTTGTACCTCGGTGCTAACGAGCCCCACGCATACTTATTCGGTG
AATGCCTTGAGGTCATGGCGACTTCAGACAATGTAGTACGAGCTGGCCTCACTTCCAAGCCGTTGGATATTCAAACACTT
TGTTCCATGCTCTCATATAAACTGGGATATCCGGAAATCCTAAAGGGATCAAGGATTCGACCATACATCACAAGATACCT
CCCGCCTTTCGAAGAGTTTGAAGTTGATCTGTGTGATCTTCCCAGTGCTGCCTCGACAGTGTTTCCCTCTGTTCCAGGCC
CTTCTCTTCTGCTTGTACTCCAAGGTGAAGGAAGAATGTCTACAGAAGCATCAGCAGATGGGATTTCAATGGGAGATGTT
TTATTTGTGCCTGCAGATACCGAGATTCACTTGAGGTCATCATCTGACTTGAAGTTGTACAGAGCAGGAATCAACAGTAG
GTTTTTGTATCCTCTATAG