Details for Lyrate rockcress Locus 16035043

Position : sca3 ( 5`- 3182817 .. 3184001 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16035043

Protein [Map View]
MEDVSESDNVETSIIHLPDDCLSFIFQRLDNVADHDSFGLTCHRWLNIQNISRRSLQFQCSFTVLNPASLSQTNPDVNSY
HLHRLLTRFQWLEHLSLSGCTVLNDSSLASLRYPGARLHSLYLDCCFGISDDGISTIASFCPNLRVVSLYRCNISDIGLE
TLARASLSLKCVNLSYCPLVSDLGIKALSQACLQLESVKVSNCKSITGVGFNGCSPTLGYVDAESCQLEPKGIMGIISGG
GIEFLNISGVSCYIRKDGLVPIGSGIASKLRMLNLRMCRTVGDASIEAIAKGCPLLQEWNLALCHEVKVSGWKAVGKWCR
NLKKLHVNRCRNLCDQGLLALRCGCMNLQILYMNGNARLTPTAIEMFRLHRADITLRTEEMMVIGPDWRLYAQE*

DNA
ATGGAAGATGTGTCCGAGTCTGATAATGTTGAGACCTCCATTATCCACCTTCCAGATGATTGCTTATCCTTTATCTTCCA
ACGACTTGATAATGTTGCTGACCATGATTCATTTGGTTTGACTTGTCATCGCTGGCTCAACATCCAAAACATTAGCCGTC
GATCTTTACAGTTCCAGTGTTCTTTCACTGTCCTGAACCCTGCTAGTCTGTCTCAGACAAATCCTGATGTCAATTCCTAT
CATCTCCACAGGCTTCTCACTCGATTTCAGTGGTTGGAGCATCTTTCCCTTTCTGGTTGCACGGTGCTGAATGATTCGAG
TCTCGCCTCGCTCAGGTATCCTGGTGCAAGACTGCATAGTCTTTACTTAGATTGTTGCTTTGGGATTTCTGATGATGGGA
TCTCCACAATTGCTAGCTTTTGTCCCAATCTCAGAGTTGTTAGTCTCTACCGCTGCAACATCAGTGACATTGGATTGGAG
ACATTGGCCAGGGCTTCCTTGTCTCTAAAATGCGTGAATCTCTCGTACTGCCCTCTGGTATCTGATTTAGGGATAAAAGC
ATTGTCACAAGCATGCTTGCAGCTTGAGTCAGTGAAAGTCTCAAACTGCAAGAGCATTACTGGTGTTGGCTTTAATGGCT
GTTCTCCAACTCTAGGCTATGTGGATGCAGAGTCTTGTCAGCTTGAGCCGAAGGGTATAATGGGGATCATTAGCGGAGGT
GGGATTGAGTTTCTTAATATTTCAGGTGTAAGTTGCTACATCCGCAAAGATGGTTTGGTACCTATTGGATCTGGGATTGC
ATCAAAACTTAGAATGTTGAACCTAAGGATGTGCAGAACGGTTGGTGATGCATCCATCGAAGCTATAGCAAAAGGTTGTC
CATTGCTCCAAGAGTGGAACCTGGCTTTGTGTCATGAAGTTAAGGTTTCGGGATGGAAAGCCGTCGGAAAGTGGTGCCGT
AACTTGAAGAAACTCCATGTGAACCGTTGTAGGAACTTATGTGACCAAGGGTTACTTGCTCTACGATGCGGTTGCATGAA
CCTCCAGATTCTCTACATGAACGGGAATGCGAGGCTGACCCCTACAGCAATTGAGATGTTCAGATTACATAGAGCCGATA
TAACACTAAGGACAGAAGAAATGATGGTCATAGGACCAGACTGGAGACTATATGCACAAGAATGA