Details for Lyrate rockcress Locus 16034988

Position : sca3 ( 5`- 2549303 .. 2546336 -3` )
Annotation : [B2G] emb3004 mee32
External links : CoGe
PGDD synteny : 16034988

Protein [Map View]
MAASSTNARLTNPPHVLSKPRLSPTSVVNLRFPAADFPIRLSAGSSSPQLRSVPFPVVFSDRSRRRTMEHSNVYVASNST
DMEIGSQDIVKNPSLICAPVMADSIDKMVIETFKAHELGADLVEIRLDWLKDFNPIEDLKTIIKKSPLPTLFTYRPKWEG
GQYEGDENERQDVLRLAMELGADYVDVELQVASDFIKSIDGKKPESFRVIVSSHNYQNTPSVEDLNDLVARIQQTGADIV
KIATTAVDIADVARMFHITSSAQGPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIG
PDTKVYGIIGKPVSHSKSPIVHNQAFKSVDFKGVYVHLLVDNLASFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAK
SIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRRSGDPSSGPSSSSPLAGKTVVVIGAGGAGKALAYGAKEKGAKVV
IANRTYERALELAEAIGGRALSLTDLDNFHPEDGMVLANTTSMGMQPNVDETPISKHALKHYALVFDAVYTPRITRLLRE
AEESGAITVSGSEMFVRQAYEQFEIFTGLPAPKELYWQIMSKY*

DNA
ATGGCAGCTTCTTCAACTAATGCTCGTCTCACCAACCCTCCTCACGTACTATCCAAACCACGACTCTCACCAACCTCCGT
CGTGAATCTCCGTTTTCCAGCCGCCGATTTCCCTATCCGCTTATCTGCCGGTTCTTCGTCCCCGCAACTAAGGAGTGTGC
CGTTTCCGGTGGTATTTTCCGATCGAAGCCGTCGGCGAACCATGGAACATAGCAATGTCTATGTGGCTTCAAATTCAACG
GATATGGAGATCGGAAGTCAAGATATTGTGAAGAATCCGAGCTTGATCTGTGCTCCAGTGATGGCGGATTCAATCGACAA
GATGGTGATTGAAACGTTTAAAGCCCATGAATTGGGTGCAGACTTGGTTGAAATTCGATTAGATTGGCTTAAGGATTTCA
ACCCTATTGAGGATCTCAAAACCATTATTAAGAAATCTCCTCTGCCCACTCTCTTCACCTACAGACCAAAATGGGAAGGT
GGTCAATATGAAGGTGATGAAAACGAAAGACAGGATGTGCTTCGTCTGGCCATGGAGTTGGGAGCTGATTACGTTGATGT
TGAACTTCAGGTTGCAAGTGACTTCATCAAATCTATTGACGGAAAGAAGCCTGAAAGTTTCAGAGTAATTGTTTCATCGC
ACAACTATCAGAATACTCCTTCTGTTGAGGATCTTAATGACCTTGTTGCAAGAATACAACAGACTGGAGCCGACATAGTG
AAGATTGCTACTACTGCTGTGGACATTGCAGATGTTGCTCGCATGTTCCATATAACCTCAAGTGCTCAAGGTCCCACAAT
TGGACTTGTGATGGGCGAGCGAGGTCTAATGTCTCGGATTCTTTGTTCGAAATTTGGTGGTTATTTGACCTTCGGCACCT
TAGATTCTAGTAAAGTTTCTGCGCCAGGTCAACCAACGATCAAGGATCTGTTAGATCTTTACAACTTTAGAAGAATTGGT
CCTGACACAAAGGTGTATGGAATTATTGGCAAGCCTGTTAGTCACAGCAAATCACCTATTGTTCACAATCAAGCTTTCAA
ATCAGTTGATTTTAAGGGAGTATATGTCCACCTATTAGTTGATAATCTTGCAAGCTTTCTTCAAGCATACTCATCCTCTG
ATTTCGCTGGATTCAGCTGTACAATTCCTCACAAAGAAGCTGCATTGCAATGTTGTGATGAGGTTGATCCATTGGCAAAG
TCTATAGGAGCTGTGAACACTATACTAAGGAGAAAAAGCGACGGAAAGTTGTTGGGTTATAACACAGATTGTATTGGTTC
CATATCTGCTATTGAGGATGGCCTACGAAGATCAGGTGATCCAAGCAGTGGACCTTCTTCTTCTTCGCCATTAGCCGGTA
AAACAGTGGTGGTTATTGGTGCTGGTGGAGCTGGCAAGGCACTTGCTTATGGTGCAAAAGAAAAGGGGGCCAAAGTTGTA
ATTGCTAATAGAACTTACGAACGAGCACTAGAACTCGCAGAAGCAATCGGAGGGAGAGCGTTATCTCTCACAGATTTAGA
TAACTTTCACCCAGAAGATGGCATGGTTTTGGCCAACACCACATCTATGGGTATGCAACCAAATGTTGACGAGACTCCAA
TTTCTAAGCATGCATTGAAGCACTACGCACTGGTCTTTGATGCGGTCTACACTCCGAGAATCACCCGACTGTTGAGGGAA
GCAGAAGAAAGTGGAGCCATAACTGTGTCAGGCTCAGAGATGTTTGTCAGGCAAGCTTATGAGCAGTTTGAGATTTTCAC
CGGTTTACCCGCTCCAAAGGAACTCTACTGGCAAATAATGTCAAAGTACTGA