Details for Lyrate rockcress Locus 16034983

Position : sca3 ( 5`- 1234195 .. 1233450 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034983

Protein [Map View]
MESSSNHMACLLKIESPTPGWKKSLEKLLKTINDVSFMIDKQSKTVYLSGKIDPQVILEKITKAGKKAVIVWSNNGQSKQ
PENRKDHLMEQCYASGYMNVPNGFSNYPPPNYWMNQPQPYNHTLCPPPPYTRQLHPQPPPPPPYEFHQKEPVAKSFPPTP
VPPKNFTMGDLTLGCMIM*

DNA
ATGGAATCATCTTCCAATCACATGGCATGTCTCTTGAAGATAGAATCTCCTACACCGGGATGGAAGAAATCTTTGGAAAA
ATTACTCAAGACCATTAATGATGTGAGTTTCATGATTGACAAGCAAAGCAAAACGGTATATCTATCTGGAAAAATCGATC
CACAAGTAATACTTGAAAAGATTACAAAAGCAGGCAAAAAAGCAGTTATAGTATGGAGCAATAATGGACAGAGTAAGCAG
CCGGAAAATCGAAAAGACCATTTGATGGAACAATGTTATGCGTCGGGATACATGAATGTTCCTAATGGTTTCTCAAACTA
TCCTCCGCCTAATTATTGGATGAATCAACCGCAACCATACAACCACACTTTATGTCCTCCACCACCATATACACGTCAGC
TCCATCCGCAGCCACCACCACCACCACCGTACGAATTCCACCAGAAAGAACCGGTGGCTAAGAGTTTTCCGCCTACACCA
GTTCCGCCTAAAAACTTTACGATGGGAGATTTGACACTAGGTTGCATGATAATGTGA