Details for Lyrate rockcress Locus 16034982

Position : sca3 ( 5`- 1063557 .. 1062150 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034982

Protein [Map View]
MSRFPPNVDAHLRPPGLIPNRPVNPFLQNANPNPNLIQQANKFQQQQQMMMMMQQQQQQKLMRPSNQLEIQFAYQDAWRV
CHPDFKRPFASLEDACERLLPYHVVADYEAEEDDSILYSDTTNQALPRCQLWDNNIAAKVAEFTATFEEQIQAFNRITQK
RRDGVRAEEMLMMEQFLLQDERNACIELDREMKAQDARLRMAALAQAAGQARAAESQQSHTEMMARNPLRANAIGNHGEQ
GRNMNPNEMMMLMNGWGNNNSQKEEKEPLEDFLNDEENENGEHENWRRTGDFDLNTR*

DNA
ATGTCGAGGTTTCCGCCGAACGTCGACGCTCATCTTCGGCCACCGGGTTTGATTCCGAACCGACCCGTTAACCCGTTTCT
TCAGAACGCTAACCCTAACCCTAATTTGATTCAACAAGCCAATAAATTTCAGCAACAGCAACAGATGATGATGATGATGC
AACAACAGCAACAGCAGAAATTGATGCGTCCATCGAATCAATTGGAGATACAATTCGCTTACCAAGACGCTTGGCGTGTT
TGCCATCCTGATTTCAAGCGACCTTTCGCTTCTCTCGAAGACGCTTGTGAAAGATTGTTACCTTATCACGTCGTAGCAGA
TTACGAAGCAGAAGAAGATGATAGTATCCTCTATTCAGACACAACAAACCAGGCGCTACCCCGCTGTCAGCTATGGGACA
ACAACATTGCAGCCAAAGTCGCAGAATTCACGGCGACATTTGAGGAACAAATCCAAGCTTTCAACAGGATAACTCAAAAG
AGAAGGGATGGCGTCAGAGCTGAGGAAATGCTGATGATGGAACAATTTTTGCTCCAAGACGAGAGAAACGCATGTATTGA
ACTGGATAGGGAGATGAAAGCTCAGGATGCGAGGTTAAGAATGGCGGCTTTGGCTCAAGCAGCAGGACAAGCAAGGGCAG
CAGAGTCACAACAATCTCATACCGAGATGATGGCTCGTAACCCGTTGAGAGCTAATGCGATTGGGAATCATGGAGAACAA
GGACGTAACATGAACCCTAATGAGATGATGATGCTGATGAATGGATGGGGGAACAATAATAGCCAGAAAGAAGAGAAGGA
ACCACTAGAAGATTTCTTGAATGATGAGGAAAATGAAAATGGAGAACATGAGAACTGGCGACGAACTGGGGATTTTGATT
TGAATACTCGGTAA