Details for Lyrate rockcress Locus 16034960

Position : sca3 ( 5`- 7109928 .. 7111835 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034960

Protein [Map View]
MNSNFGKRSSGPINSFDFDLGLGSSQGRPLNGQKSQTSSYTSSNSQPRPAWQPGKPSWTHQPAPKQSTIRSEIGSGPTSM
VGDIHGKTWGSASGSGSGIGIVNKDPSLFGDLVGSAIGQGKSSRNVPLKNAPPVSASGSSKSPYSMGNFADSLPKSGNSM
KPGGGMGYSSNPSGFSGGYKSSGGMNSGVNANSSPNLGGPSMKNMSGGNLSGSGLSSNSDPFGSLVGFGSKPSGSINSGI
KTGKVNNNAQSDAFGNFQGVSNVNSSGFASKSNTFSSGGGFNASNVDFCVQPSGPQSSSANDDPLGMFSSSKPTAAAATP
QTEDWGFESFDGGAGSTTELDGLPPPPPGVSATSAKSKGIDNQRQGQYADAIKWLSWAVILMDRAGDEAGSAEVLSTRAS
CYKEVGEYKKAVADCTKVLDHDKKNVTILVQRALLYESMEKYKLGAEDLRMVLKIDPGNRIARSTVHRLTKMAG*

DNA
ATGAATTCCAACTTCGGGAAGAGATCATCGGGACCGATCAATAGCTTCGATTTCGATCTGGGACTCGGATCGAGCCAAGG
TAGACCTCTTAATGGTCAGAAGAGCCAAACATCTTCCTATACAAGCTCGAATTCGCAGCCGAGACCTGCGTGGCAGCCTG
GTAAGCCGTCGTGGACGCATCAACCTGCACCGAAGCAGAGTACGATCCGATCCGAGATCGGAAGTGGACCGACTTCAATG
GTGGGTGATATTCATGGTAAGACTTGGGGTTCAGCTTCGGGATCGGGTTCGGGGATTGGGATTGTGAATAAGGATCCTAG
TTTGTTTGGAGATCTGGTGGGTTCTGCGATAGGTCAAGGTAAATCTAGTAGAAACGTGCCGTTGAAGAATGCACCGCCTG
TTTCGGCTTCAGGTTCGAGTAAGAGTCCTTATTCTATGGGGAATTTTGCTGATTCGTTGCCCAAATCTGGTAATTCGATG
AAACCTGGTGGTGGTATGGGTTATAGCAGTAATCCGAGTGGATTTTCTGGTGGTTACAAGAGCTCCGGTGGTATGAATTC
TGGTGTTAATGCTAATAGTAGTCCAAATCTTGGTGGTCCTTCAATGAAAAATATGTCTGGGGGCAATCTGAGTGGGTCTG
GTCTTTCTTCGAACAGTGATCCATTTGGTTCTTTGGTTGGTTTCGGATCAAAACCATCAGGAAGCATCAATTCTGGAATC
AAAACAGGAAAGGTTAACAACAATGCACAGAGTGATGCTTTTGGGAATTTTCAAGGAGTGTCGAACGTTAACAGTAGCGG
TTTTGCTTCGAAATCAAACACATTCTCATCAGGCGGTGGCTTCAATGCTTCAAACGTTGATTTTTGTGTGCAACCAAGTG
GTCCTCAATCTTCAAGTGCAAACGATGATCCATTAGGAATGTTCTCTAGTTCCAAACCCACAGCTGCAGCGGCTACACCA
CAGACTGAAGATTGGGGATTTGAAAGCTTTGACGGTGGGGCTGGTTCCACCACCGAGCTTGATGGTTTGCCACCACCTCC
ACCTGGTGTATCAGCTACATCAGCTAAGAGCAAGGGCATTGATAACCAGAGACAAGGTCAGTATGCTGATGCCATAAAGT
GGCTCTCTTGGGCTGTGATTCTTATGGATAGAGCTGGTGATGAAGCTGGATCAGCCGAGGTTCTTTCAACAAGGGCTTCG
TGTTACAAAGAAGTTGGAGAGTATAAGAAGGCTGTGGCCGATTGCACAAAGGTACTTGATCACGACAAGAAGAATGTGAC
CATTCTGGTTCAACGAGCACTCTTATATGAGAGCATGGAGAAATACAAACTCGGAGCTGAAGACCTAAGGATGGTTCTAA
AGATCGATCCCGGGAATAGAATTGCTAGAAGCACTGTTCACCGCCTAACCAAAATGGCTGGTTGA