Details for Lyrate rockcress Locus 16034959

Position : sca3 ( 5`- 7213998 .. 7212037 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034959

Protein [Map View]
MRGFASSASRIATAAAASKALNPKLSKTLNSSGKPTNPLNQRYISQVIERKDWFLILNQEFTTHRIGLNIRFVISVLQNQ
DNPLHSLRFYLWVSNTDPVYAKDQSLKSVLGNALFRKGPLLLSMELLKEIRESGYRITDELMCVLIGSWGRLGLAKYCND
VFAQISFLGMKPSTRLYNAVIDALVKSNSLNLAYVKFQQMRSDDCKPDRFTYNILIHGVCKKGVVDEAIRLVKQMEREGN
RPNVFTYTILIDGFLIAGRIEEALKQLEMMQVRKLNPNEATIRTLVHGIFRCLPPCEAFEVLLGFMEKNSILQRVAYDTV
LYCLSNNSMAKETALFLRKTGERGYIPDSSTFNAAMNCLLKGHHLVETCGIFDCFVSRGAKPGFNGYLVLVQALLNAQRF
SAGDRYLKQMGGDGLLSSVYTYNAVIDCLCKARRTEHAAMFLTEMQDRGISPNLITFNTFLSGYSAGGDVKKVHGVVEKL
LEHGCNPDVITFSLIINCLCRAKEIKDAFDCFKEMLEWGIKPNEITYNILIRSSCSTGDTGRSVKLFANMKESGLSPNLY
AYNAIIQSFCKMKKVKKAEELLKTMLRIGLKPDNFTYSTLIKALSESGRESEAREMFSSMERHGCVPDSYTKRLVEELDL
RQSGLSRETVSAS*

DNA
ATGAGAGGCTTTGCTTCTTCAGCATCTAGAATAGCGACGGCGGCAGCAGCTTCCAAAGCCCTAAACCCTAAACTCTCAAA
AACCCTAAATTCCTCAGGTAAACCAACCAATCCTCTGAACCAGCGTTACATTTCGCAAGTCATAGAGCGAAAAGATTGGT
TTTTGATACTGAATCAAGAATTCACCACTCATCGAATTGGTTTAAACATTCGATTCGTCATCAGCGTTTTGCAGAATCAA
GACAACCCATTACACTCCCTGCGATTTTACCTCTGGGTCTCCAACACCGACCCGGTTTACGCTAAGGATCAGTCTCTGAA
GAGCGTTCTAGGGAACGCACTTTTTCGTAAAGGCCCTTTATTGTTGTCTATGGAATTGCTTAAGGAGATTAGAGAATCAG
GGTATCGAATTACTGATGAATTGATGTGTGTTTTGATCGGAAGCTGGGGAAGATTAGGTTTAGCTAAGTATTGTAATGAT
GTTTTTGCTCAGATATCTTTTCTTGGAATGAAACCAAGTACAAGGCTTTATAATGCTGTGATTGATGCGTTGGTGAAGTC
TAATTCACTTAATTTGGCTTACGTGAAGTTTCAGCAGATGCGTAGTGATGATTGTAAACCTGATCGGTTTACCTATAATA
TACTCATCCATGGTGTTTGCAAGAAGGGTGTGGTTGATGAGGCGATTCGATTGGTTAAACAGATGGAACGAGAAGGGAAC
AGACCTAATGTGTTCACTTATACGATTTTGATCGACGGGTTTTTGATCGCGGGGAGGATTGAGGAGGCATTGAAGCAATT
GGAGATGATGCAGGTAAGAAAGTTGAATCCTAATGAAGCTACAATCAGAACTTTGGTCCATGGGATTTTTCGTTGCTTGC
CGCCGTGTGAAGCGTTTGAGGTTTTGCTTGGATTTATGGAGAAAAACTCGATTTTGCAAAGAGTAGCTTATGATACTGTG
TTGTATTGTCTTTCAAACAACTCAATGGCTAAAGAGACTGCTCTATTCTTGAGGAAAACGGGTGAGCGAGGTTATATTCC
GGATAGCTCAACGTTCAATGCTGCGATGAATTGTCTCTTAAAAGGGCATCATCTGGTTGAGACGTGTGGGATATTTGACT
GTTTTGTCAGCCGTGGAGCTAAGCCAGGATTTAACGGTTATCTTGTATTAGTTCAAGCTCTGTTGAATGCTCAGAGGTTC
TCTGCAGGTGACCGGTATCTGAAACAAATGGGTGGTGATGGGCTTCTATCAAGTGTATATACTTATAATGCGGTTATTGA
CTGTCTCTGCAAGGCTCGACGGACAGAGCATGCAGCAATGTTCTTAACAGAGATGCAGGATAGAGGTATTTCTCCGAATC
TCATAACTTTCAATACTTTTCTAAGCGGTTATAGCGCGGGGGGCGATGTAAAGAAGGTTCACGGCGTGGTAGAGAAGCTT
CTTGAACATGGTTGCAACCCAGACGTGATCACTTTCAGTTTGATCATAAACTGTCTTTGCCGAGCAAAAGAAATCAAAGA
TGCATTTGACTGTTTCAAGGAGATGTTGGAATGGGGGATTAAACCAAATGAGATCACATACAATATCCTGATTCGCTCCT
CTTGTTCAACCGGAGATACCGGTAGATCAGTGAAGCTGTTTGCGAATATGAAGGAAAGCGGGTTAAGTCCAAACCTTTAT
GCGTACAATGCGATTATTCAGAGTTTTTGCAAGATGAAAAAGGTTAAGAAGGCTGAGGAATTGCTTAAAACAATGTTGAG
GATTGGTTTGAAACCAGATAACTTTACATACAGCACTCTCATCAAAGCTCTAAGTGAATCTGGAAGAGAGAGTGAAGCGA
GAGAGATGTTCAGTTCAATGGAAAGACATGGATGTGTTCCGGATTCATATACTAAGCGTCTTGTTGAAGAACTTGACCTT
AGACAAAGTGGACTCTCGAGAGAAACCGTGTCAGCCTCATAG