Details for Lyrate rockcress Locus 16034957

Position : sca3 ( 5`- 2982301 .. 2980923 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034957

Protein [Map View]
MAEEAHKVTLNVYDLSQGLARQLSQSLLGKVIEGVWHTGIVVYGNEYFFGGGIQHLPVGRTPYGTPIRTIELGLSHVPKD
VFEMYLEEISPRYTAESYNLLTHNCNNFSNEVAQFLVGKGIPDYILQLPNDVLNSPMGGLIMPMLQGLETTLKAGAVPQV
PQFRPQPQPFGAFSKDEGPKIEKASKPEAAEISAATEKVPPVVQPSASKEKVKEDPLGDARAKIQEEITTEFAALMAQGT
LRASEAAAMATKRVMQKYGQLNVNT*

DNA
ATGGCTGAGGAAGCGCATAAGGTAACGTTGAATGTCTATGACCTAAGCCAAGGCTTGGCACGCCAGCTCTCGCAATCACT
CTTGGGGAAGGTTATCGAAGGTGTATGGCATACAGGAATAGTTGTCTATGGAAATGAGTACTTTTTTGGAGGAGGAATAC
AGCATTTGCCAGTTGGACGAACTCCATATGGAACACCAATTCGAACGATAGAGTTGGGTCTATCACATGTTCCTAAAGAT
GTATTCGAGATGTATTTGGAAGAAATCAGTCCTCGTTACACCGCTGAATCTTACAATCTACTTACTCACAATTGCAACAA
CTTCAGCAACGAGGTTGCTCAGTTTTTGGTGGGTAAAGGGATTCCTGACTACATTCTTCAGCTTCCCAATGATGTTCTAA
ACAGCCCCATGGGTGGTCTTATAATGCCTATGTTACAAGGCCTCGAAACAACTCTAAAAGCTGGTGCTGTTCCTCAAGTT
CCACAGTTTAGGCCACAGCCACAACCTTTTGGAGCTTTTAGTAAAGATGAAGGTCCAAAAATTGAGAAAGCCTCTAAGCC
TGAGGCAGCGGAAATCTCAGCTGCAACTGAGAAAGTGCCACCTGTTGTTCAACCATCAGCTAGTAAAGAGAAGGTGAAGG
AGGACCCGTTGGGTGATGCTAGGGCCAAGATTCAGGAAGAGATTACAACTGAATTTGCAGCCCTCATGGCACAAGGCACA
TTACGAGCAAGTGAAGCAGCAGCTATGGCGACTAAAAGAGTCATGCAAAAGTATGGACAACTCAATGTAAATACTTAA