Details for Lyrate rockcress Locus 16034955

Position : sca3 ( 5`- 7344880 .. 7344414 -3` )
Annotation : [B2G] invertase pectin methylesterase inhibitor family protein
External links : CoGe
PGDD synteny : 16034955

Protein [Map View]
MIGALNAQVADIKAICGKAKNQSFCTSYMKSNPKTSGADLQTLAKITFGSAQTSASEGFKKIQSLVKTATNPTMKKAYTS
CVQHYKSAISSLNDAKQSLASGDGKGLNIKVSAAMEGPSTCEQDMANFKVDPSAVKNSGDFQNICGIVLVISNMM

DNA
ATGATTGGTGCCTTGAATGCACAAGTAGCAGACATAAAAGCAATCTGTGGGAAAGCGAAAAACCAATCCTTCTGCACTAG
CTACATGAAATCCAACCCAAAGACCTCAGGTGCTGATCTTCAAACGCTAGCAAAGATCACCTTTGGTTCTGCACAAACAA
GTGCATCAGAAGGTTTCAAGAAAATTCAATCCCTAGTCAAGACAGCAACCAACCCCACTATGAAGAAAGCATACACCTCG
TGCGTACAACATTATAAGAGTGCAATCAGCAGTCTCAATGATGCTAAGCAGAGCCTGGCGTCAGGCGATGGGAAAGGGCT
GAACATTAAGGTCTCAGCAGCTATGGAAGGACCTTCAACATGTGAACAAGACATGGCGAATTTCAAAGTAGATCCTTCAG
CTGTGAAGAACAGTGGTGATTTTCAGAATATTTGTGGCATTGTTCTTGTCATCTCAAACATGATGTG