Details for Lyrate rockcress Locus 16034952

Position : sca3 ( 5`- 4022014 .. 4021331 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478336 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034952

Protein [Map View]
MEANTLFLLKALCLLCFSVCFTLASDPDPIQDFCIPKPMTSPYHDHHFSTNLPCKNSSEVTTEDFVFSGLKTVGNFTETG
FATVPVSPVNFPGLNTLGLSFVRADLKPGSINPPHYHPRATEVAHLVKGRVYSGFVDSNNKVYAKVMEEGEMMVYPKGLV
HFQMNVGDVTATIVGGLNSQNPGIQKIPSVVFGSGINEELLMKAFGLSLKQIGTLKKRFDPVMSNEH*

DNA
ATGGAAGCAAACACTCTGTTTCTTCTAAAGGCTCTTTGTCTTCTCTGTTTTAGTGTATGCTTCACATTGGCTTCCGACCC
TGATCCCATCCAAGACTTCTGTATACCAAAACCTATGACATCTCCTTATCATGACCATCACTTCTCCACCAATCTTCCTT
GCAAAAACTCCTCCGAAGTAACCACCGAAGATTTTGTCTTTTCCGGTCTAAAAACTGTCGGAAACTTCACGGAGACTGGC
TTCGCCACCGTCCCAGTAAGCCCGGTAAACTTCCCGGGCCTTAACACATTAGGCCTGTCGTTTGTCCGGGCTGATCTCAA
ACCAGGATCCATAAACCCACCACATTACCACCCGCGGGCCACGGAAGTAGCCCACTTGGTTAAAGGACGGGTTTACTCCG
GTTTTGTGGACTCGAACAATAAGGTTTACGCAAAAGTGATGGAAGAAGGAGAAATGATGGTTTACCCCAAAGGGCTTGTG
CATTTTCAGATGAACGTGGGAGATGTTACGGCCACGATTGTCGGCGGACTTAATAGCCAAAACCCTGGTATTCAGAAGAT
ACCGTCGGTTGTTTTTGGATCAGGGATCAATGAGGAGTTGCTTATGAAAGCTTTTGGGTTGAGTCTTAAGCAGATTGGTA
CGTTGAAGAAAAGATTTGATCCTGTCATGTCTAATGAGCATTGA