Details for Lyrate rockcress Locus 16034931

Position : sca3 ( 5`- 1127121 .. 1125768 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034931

Protein [Map View]
MSSVAAMVFRGARSLLAPASRATSSLVSTGSTKKTAAKTKAKAKAKPKPKAKSESPAKKTPRSTGLFKVTPVSPVLAQFL
GTGETTRTDAIKGIWTYIKSHDLQNPADKREIFCDETLKLIFEGKDKVGFLEISKLLSPHFVKTA*

DNA
ATGTCTTCCGTTGCAGCTATGGTTTTCAGGGGAGCTAGATCGCTTCTAGCTCCTGCTTCTCGAGCCACCTCTTCTTTGGT
TTCAACTGGATCCACTAAGAAAACGGCGGCGAAAACAAAGGCCAAGGCCAAGGCTAAGCCTAAGCCAAAGGCGAAATCAG
AGTCTCCGGCAAAGAAGACACCGAGGTCTACCGGACTCTTTAAGGTGACTCCTGTGTCTCCAGTTCTCGCTCAGTTCCTT
GGTACCGGTGAAACTACACGTACCGACGCCATCAAGGGGATTTGGACCTACATCAAATCCCACGATCTTCAGAACCCAGC
TGACAAGAGGGAGATTTTCTGCGATGAGACACTGAAGCTAATCTTTGAAGGGAAAGACAAAGTTGGGTTTCTAGAGATTT
CAAAACTCTTGTCCCCGCACTTTGTGAAGACTGCTTGA