Details for Lyrate rockcress Locus 16034921

Position : sca3 ( 5`- 10238614 .. 10240572 -3` )
Annotation : [B2G] AT-HSFA6B [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034921

Protein [Map View]
MDPSFRFIKEEFPTGFSDSPSPPSSSSSSYLYSSSMAEAALYDPTTLSYPQPIEGLHESGPPPFLTKTYDLVEDSRTNHV
VSWSKSNNSFIVWDPQAFSITLLPRFFKHNNFSSFVRQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKNIRRRKTSNNSN
QLQQPQSSEQQSLDNFCIEVGRYGLDGEMDSLRRDKQVLMMELVRLRQQQQSTKMYLTLIEEKLKKTESKQQQMMGFLAR
AMQNPDFIQQLVEQKEKRKEIEEAISKKRQRPIDQGKRNVVNVGDYDDASGYVNDAAASTSASASAFLDMSQETYGNMSE
FEMSDLDKLAMHIQGLGDHSSTREEVLNVEKGNDEEEEEDQQQGYQKENKEIYGEGFWEDLLNEGQNFDFEGDQENVDVL
IEQLGYLGSSSHTS*

DNA
ATGGATCCATCATTTAGATTCATTAAAGAGGAGTTTCCTACTGGATTCAGTGATTCTCCATCACCACCATCTTCTTCTTC
TTCCTCATACCTTTATTCATCTTCCATGGCTGAAGCAGCCCTATATGATCCAACAACATTGAGCTATCCACAACCAATAG
AAGGTCTCCATGAATCAGGGCCACCTCCATTTTTGACAAAGACATATGACTTGGTAGAAGATTCAAGAACCAATCATGTA
GTGTCTTGGAGCAAATCCAATAATAGCTTCATTGTTTGGGATCCACAAGCTTTTTCCATCACTCTCCTCCCCAGATTCTT
CAAGCACAATAACTTCTCCAGTTTTGTCCGCCAGCTCAACACATATGGTTTCAGAAAGGTGAATCCGGATCGATGGGAGT
TTGCAAATGAAGGGTTTCTAAGAGGGCAAAAGCATCTCCTTAAGAACATAAGGAGAAGAAAAACAAGTAACAATAGTAAT
CAACTGCAACAACCTCAAAGTTCTGAACAACAATCTCTAGACAATTTTTGCATAGAAGTTGGTAGGTATGGTCTAGATGG
AGAGATGGACAGCCTAAGGCGAGACAAGCAAGTTCTGATGATGGAACTAGTGAGACTGAGACAACAACAACAAAGCACCA
AAATGTATCTCACTTTGATTGAAGAGAAGCTGAAGAAGACGGAATCGAAACAACAACAAATGATGGGCTTCCTTGCCCGT
GCAATGCAGAATCCAGATTTTATTCAGCAGCTCGTAGAGCAGAAGGAAAAGAGGAAAGAGATAGAAGAGGCCATCAGCAA
GAAGAGACAAAGACCGATCGATCAAGGGAAAAGAAATGTTGTTAATGTGGGAGATTATGATGATGCAAGTGGTTATGTGA
ATGATGCTGCAGCCTCAACCTCAGCCTCAGCCTCAGCTTTTCTTGATATGAGTCAAGAAACATATGGAAACATGTCTGAA
TTCGAGATGTCGGATTTGGACAAACTTGCTATGCACATTCAAGGACTTGGAGATCATTCCAGTACTAGGGAAGAAGTCTT
GAATGTGGAAAAAGGAAATGATGAGGAAGAAGAAGAAGATCAACAACAAGGGTACCAAAAGGAGAACAAGGAGATTTATG
GTGAAGGTTTTTGGGAAGATTTGTTAAATGAAGGTCAAAATTTTGATTTTGAAGGAGATCAAGAAAATGTTGATGTGTTA
ATTGAGCAACTTGGTTATTTGGGTTCTAGTTCACACACTAGTTAA