Details for Lyrate rockcress Locus 16034890

Position : sca3 ( 5`- 8237695 .. 8237363 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034890

Protein [Map View]
MNEDVLEALGCLVFFAILTVFYCVFRCCLAYCDNGDDDDHPNHPGHSLHVIKAAGIGLSVLQSIPVLSFNAHDFKDNVEC
VVCLSKLVVIDHCFHVDCIDTWLQSSKYKR*

DNA
ATGAACGAAGATGTTCTCGAAGCTCTAGGATGTCTCGTCTTCTTCGCGATTCTGACTGTGTTTTATTGTGTATTTCGTTG
TTGTCTTGCTTATTGCGACAACGGTGATGATGATGATCATCCAAATCATCCCGGTCATAGTTTACATGTAATAAAAGCTG
CTGGGATAGGCCTTTCCGTTCTCCAATCGATCCCCGTCTTATCTTTCAACGCTCATGACTTTAAAGATAACGTCGAATGC
GTCGTTTGTCTATCGAAGCTCGTTGTAATCGATCACTGCTTTCACGTTGATTGTATCGACACATGGCTTCAATCCTCCAA
GTACAAACGCTAA