Details for Lyrate rockcress Locus 16034876

Position : sca3 ( 5`- 2495392 .. 2496530 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477927 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034876

Protein [Map View]
MGCVQCKCCSRYPSSSSDGDSRGPLEANGIVKGKDQKPLGSIHVPSPNFDMVYSVLSQRGYYPDSPDKENQDTYCIKTEL
QGNPNVHFFGVFDGHGVFGTQCSNFVKERVVEMLSEDPTLLEDPEKAYKSAFLRVNEELHDSEIDDSMSGTTAITVLVVG
DKIYVANVGDSRAVLAVKDRNRILAEDLSYDQTPFRKDECERVKACGARVLSVDQVEGLKDPNIQTWANEESEGGDPPRL
WVQNGMYPGTAFTRSVGDFTAESIGVTAEPEVSMVHLSPNHLFFVVASDGIFEFLPSQAVVDMVGRYADPRDGCAAAAAE
SYKLWLEHENRTDDITIIIVQIKKLSNE*

DNA
ATGGGTTGTGTTCAATGCAAATGCTGTAGCCGATATCCGTCGTCGTCATCAGATGGAGATTCTCGTGGACCTTTAGAAGC
CAATGGTATTGTCAAAGGGAAAGATCAGAAACCTCTTGGATCTATTCACGTTCCTTCTCCTAATTTCGACATGGTTTACT
CTGTCTTATCTCAACGAGGCTATTATCCTGATTCACCTGATAAAGAGAATCAAGACACTTACTGCATCAAAACCGAGCTT
CAAGGTAACCCGAATGTTCATTTCTTCGGTGTGTTTGATGGTCACGGCGTGTTTGGTACGCAGTGTTCGAATTTTGTCAA
GGAGAGGGTTGTGGAAATGTTGTCTGAAGACCCAACTCTGCTTGAGGATCCTGAGAAAGCTTACAAGTCTGCTTTTTTGA
GGGTGAATGAGGAGTTACACGATAGTGAAATCGATGATTCGATGAGTGGTACTACTGCCATTACGGTTCTTGTTGTTGGG
GATAAGATTTATGTTGCCAATGTAGGGGATTCGAGGGCGGTTCTTGCTGTTAAAGACAGGAATCGGATTCTAGCAGAGGA
TTTGTCTTATGATCAAACGCCTTTTAGGAAAGATGAATGCGAGAGGGTGAAAGCGTGTGGAGCTAGAGTGCTGAGTGTGG
ATCAAGTGGAAGGATTGAAAGATCCGAATATACAAACATGGGCAAACGAAGAGAGCGAAGGAGGTGATCCGCCGAGACTT
TGGGTACAAAACGGGATGTATCCGGGAACCGCATTTACAAGGAGTGTTGGAGATTTTACAGCTGAGAGCATTGGAGTTAC
TGCAGAACCAGAAGTGTCAATGGTTCATCTTTCGCCTAACCATTTGTTCTTTGTTGTTGCAAGCGATGGGATTTTCGAGT
TTCTTCCAAGCCAAGCTGTTGTTGATATGGTGGGGAGATACGCTGATCCGCGTGATGGATGCGCTGCAGCTGCAGCGGAA
TCATACAAACTGTGGTTGGAGCATGAGAATAGGACAGATGATATCACAATTATCATTGTACAGATTAAAAAGCTGTCTAA
TGAATGA