Details for Lyrate rockcress Locus 16034869

Position : sca3 ( 5`- 3607178 .. 3607516 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034869

Protein [Map View]
MNFRSFEEFWPFYVMQHSNPLTRRWHFIGIIASIVALMCSILINWWFVALVPLLGYGFAWYSHFFVEGNVPASFGHPLWS
FLCDLKMFSLMLTGSMEREMKRLGKRPLLQLS*

DNA
ATGAATTTCAGAAGCTTTGAGGAGTTCTGGCCTTTCTACGTGATGCAACACTCGAATCCGTTAACGAGGCGATGGCACTT
CATAGGTATAATCGCGAGCATCGTTGCCTTGATGTGTTCGATTTTGATCAACTGGTGGTTCGTTGCTCTGGTGCCTCTGC
TTGGGTACGGGTTCGCGTGGTATAGCCACTTCTTCGTGGAAGGGAATGTTCCGGCGAGCTTTGGGCATCCCCTTTGGTCG
TTTCTCTGCGATCTCAAGATGTTTAGTCTGATGCTCACAGGAAGCATGGAGAGAGAGATGAAGAGACTCGGTAAGAGGCC
ATTGTTGCAACTCTCTTGA