Details for Lyrate rockcress Locus 16034868

Position : sca3 ( 5`- 4937464 .. 4934896 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478582 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034868

Protein [Map View]
MGSWIPKFLLLQLVLLLTKHADSSSIIRYLPGFEGPLPFELETGYIGVGDEEEDQMFYYFIKSESNPEEDPLLVWLTAGP
GCSSFSGLVYENGPLAFKVKGYNGSIPTLVSTTYSWTKVTPAFGSLLLFRNPLADISSDTGSTKRVDEFLPKLSIEYFSN
PFYVTGNSYSGKLIPVIVQEISNGNCICCKPQINLQGYVLGSPVTDSELNKNSRIQYAHRMSLISDELYESMKRSCGGNY
IIVDPLNTQCLELIKDYDKCVSGIYENLILAPKCDLTSPDCQFAMLLWQSYRSMLSEYWANNESGTTGNGERCKWSLQSN
KDIKSSIPYHKKNSIEGYRSLIFSGDHDMLTPYIGTQDWIRSLNYSIIDKWRPWMILDQVAGYTTTYANRMTFATVKGGG
HTLDYKPKENSILFQRLVAHGQGIKPEERSIMFKIWISGQLL*

DNA
ATGGGTTCATGGATACCCAAGTTTCTGCTGCTGCAACTTGTGCTTCTGTTGACTAAGCATGCTGATTCAAGTTCTATCAT
CAGATATCTTCCTGGTTTTGAAGGCCCTCTTCCCTTCGAGCTCGAAACCGGGTACATTGGTGTTGGTGATGAAGAGGAAG
ATCAAATGTTCTACTACTTCATCAAATCTGAGAGCAATCCAGAAGAAGACCCTCTTCTTGTCTGGTTAACTGCAGGACCT
GGCTGCTCTTCTTTCTCTGGTCTTGTTTATGAGAATGGGCCTCTTGCTTTCAAGGTTAAGGGTTACAATGGAAGTATTCC
CACGTTGGTTTCTACTACATATTCATGGACTAAGGTAACACCAGCTTTTGGATCATTGCTTCTTTTTAGAAATCCACTTG
CTGATATATCAAGTGACACAGGATCAACTAAGCGGGTCGACGAGTTTCTTCCTAAGCTAAGCATCGAGTATTTCTCCAAT
CCTTTCTACGTCACCGGCAATTCTTACTCCGGTAAGTTGATTCCGGTTATCGTTCAAGAAATCTCAAATGGAAACTGTAT
ATGCTGCAAACCTCAAATAAATCTTCAGGGCTATGTGCTCGGAAGCCCGGTTACAGATTCTGAACTTAATAAAAACTCTC
GCATTCAATATGCTCATAGAATGTCACTCATATCTGATGAACTCTACGAGTCGATGAAGAGAAGCTGTGGAGGAAACTAT
ATTATTGTAGATCCTCTAAACACACAATGCTTGGAACTCATTAAAGACTATGACAAGTGTGTTTCTGGAATATATGAAAA
CCTTATCCTCGCACCAAAATGTGACCTTACATCTCCTGATTGCCAATTTGCCATGTTGCTATGGCAGTCGTATCGGTCTA
TGCTATCCGAATACTGGGCCAATAACGAGAGCGGTACTACAGGTAATGGGGAACGATGTAAATGGAGTTTGCAAAGCAAT
AAAGACATTAAAAGCAGCATACCATACCATAAAAAGAACAGCATCGAAGGCTATCGATCTCTCATCTTCAGTGGTGATCA
CGACATGCTAACACCTTACATTGGAACTCAAGACTGGATCAGATCTCTTAACTATTCCATTATTGACAAATGGAGGCCAT
GGATGATACTTGATCAAGTCGCTGGATACACTACGACTTATGCTAACAGGATGACATTTGCAACAGTGAAAGGAGGAGGG
CACACGTTAGACTATAAACCCAAGGAGAATTCAATCTTGTTCCAGAGGTTGGTGGCACACGGGCAGGGTATAAAGCCAGA
GGAAAGATCAATAATGTTCAAGATATGGATAAGTGGCCAACTTCTGTAA