Details for Lyrate rockcress Locus 16034846

Position : sca3 ( 5`- 4082838 .. 4080708 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034846

Protein [Map View]
MSSGSVRRVSRQDIQLVQNLIERCLQLYMNQKEVVDTLLEQAKIEPGFTELVWQKLEEENREFFKAYYLRLMVKHQIMEF
NKLLEQQVHHMRQMHPTGVASVQNTNGSHIQSMNQKQLCYPSEHTDQSLKSESAHHPMASSLSNAFLNGSSTLNTNVPSS
INISTHARRVDASPNMLSSHMPMVQGMNGGMIKSETAFTNPASFMYGGERNALEGHSAVGDTSISNFSNESNNQPLSDTL
LEAETSTIGFLGQIPRNFSLSDLTADFSQSSEILESYDRSPFLVANAENFLDSRERGEYQGDNKRLDTISEGFSYDNIGS
E*

DNA
ATGTCAAGTGGATCAGTGAGACGGGTTTCACGTCAAGATATACAACTGGTTCAAAACCTTATAGAACGATGCCTTCAACT
TTACATGAATCAGAAAGAAGTTGTAGATACTTTACTAGAGCAGGCTAAAATCGAGCCTGGGTTCACAGAGCTAGTTTGGC
AGAAGCTTGAAGAAGAGAATCGGGAGTTTTTCAAGGCTTACTATCTTAGGCTAATGGTTAAACACCAGATAATGGAGTTC
AACAAGTTGCTTGAGCAGCAGGTTCACCACATGCGTCAGATGCATCCAACTGGGGTTGCTTCCGTCCAAAATACTAATGG
TTCTCATATTCAATCAATGAATCAGAAACAATTATGCTATCCCTCTGAGCACACTGATCAGTCTTTGAAGTCTGAAAGTG
CACATCATCCTATGGCTTCTAGTCTGTCTAATGCATTCCTCAATGGCTCTTCAACACTCAATACAAACGTGCCCTCTTCT
ATAAACATATCAACCCATGCTAGGAGAGTTGATGCTTCTCCAAATATGCTCTCATCGCACATGCCTATGGTGCAAGGAAT
GAATGGAGGAATGATCAAATCTGAGACTGCCTTTACAAACCCTGCTTCATTCATGTATGGTGGCGAACGGAATGCCCTCG
AAGGACATTCGGCAGTTGGGGATACTTCGATTTCTAATTTCAGTAATGAGTCCAACAACCAACCTCTCAGTGATACGCTT
CTTGAAGCAGAAACTTCTACTATTGGGTTCTTAGGTCAAATTCCTCGTAACTTTAGCCTCTCTGATTTGACAGCTGATTT
TTCCCAGAGCTCAGAGATTCTGGAGAGCTACGATAGATCACCCTTCCTTGTGGCGAATGCCGAAAACTTCCTGGACTCCC
GTGAAAGAGGAGAATATCAAGGAGACAACAAGAGGTTGGATACCATATCTGAAGGTTTCAGTTACGATAACATTGGAAGC
GAGTAG