Details for Lyrate rockcress Locus 16034826

Position : sca3 ( 5`- 10261561 .. 10262721 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034826

Protein [Map View]
MLAIFDKNVAKTPEALQSQEGGSVCALKDRFLPNHFSSVYPDAVTINLGSSGFIACSLEKQNPLLPRLFAVVDDMFCIFQ
GHIENVPILKQQYGLTKTATEVTIVIEAYRTLRDRGPYSADQVVRDFQGKFAFMLYDCSTQNVFLAGDVDGSVPLYWGTD
AEGHLVVSDDVETVKKGCGRSFAPFPKGCFFTSSGGLRSYEHPSNELKPVPRVDSSGEVCGVTFKVDSEAKKEAMPRVGS
VQNWSKQI*

DNA
ATGTTGGCGATTTTCGACAAGAACGTTGCGAAAACACCCGAGGCTCTGCAGAGTCAAGAAGGTGGATCTGTTTGTGCTCT
TAAAGATAGGTTCTTGCCGAACCATTTCTCCTCTGTTTATCCTGACGCTGTCACCATCAATCTTGGATCTTCTGGTTTCA
TCGCTTGCTCTCTCGAGAAACAGAACCCTCTTCTTCCCAGATTGTTTGCTGTGGTGGATGATATGTTCTGCATTTTCCAA
GGACATATAGAGAACGTTCCAATTCTTAAGCAACAATATGGACTAACCAAAACAGCTACAGAGGTTACCATTGTGATTGA
AGCCTACAGAACTCTAAGAGATCGTGGTCCGTATTCTGCTGACCAAGTTGTTAGAGATTTTCAAGGCAAATTCGCGTTTA
TGCTCTATGACTGCTCCACACAAAATGTCTTCCTTGCTGGGGATGTAGATGGGAGTGTTCCTCTCTACTGGGGTACCGAT
GCTGAAGGCCATCTCGTTGTTTCTGATGATGTTGAGACTGTGAAGAAAGGTTGTGGTAGATCCTTTGCGCCATTCCCTAA
AGGATGTTTCTTTACCTCATCTGGAGGTTTGAGGAGCTATGAGCATCCATCAAACGAGTTAAAGCCGGTACCAAGGGTAG
ACAGTTCGGGTGAGGTGTGCGGTGTAACTTTTAAAGTGGATTCCGAGGCCAAGAAAGAAGCGATGCCTAGGGTTGGGAGT
GTCCAGAATTGGTCTAAACAAATCTGA