Details for Lyrate rockcress Locus 16034820

Position : sca3 ( 5`- 3530285 .. 3528317 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034820

Protein [Map View]
MERNYIMKMVCETACSKEAEIRQAAFECLVSIASTYYEVLEQYMPTLFELTSNAVKGDEESVALQAIEFWSSICDEEIDR
QEYDSPDSGDSSPPHSCFIEKALPHLVQMLLETLLKQEEDQDHDDDVWNISMAGGTCLGLVARTVGDGIVPLVMPFVEKN
ISSPDWRSREAATYAFGSILEGPTIDKLAPMVAAGLEFLLNATKDGNNHVRDTTAWTLSRIFEFLHSPDSGFSVISPENL
PRIVSVLLESIKDVPNVAEKVCGAIYNLAQGYEDSGANSSLLSPYLTEIITHLLAAAERTDGAESKLRGAAYETLNEVVR
CSNLSEASSIIAHLLPAIMKKLAETMDLPIISTDDREKQAELQASLCGVLQVIIQKLSGREDTKPIIMQNADDIMRLFLR
VFGCHSSSVHEEAMLAIGALAYATGAEFVKYMPELFKYLQMGLQNFEEYQVCSITVGVIGDICRALDEKILPFCDQIMGL
LIQNLQSGALHRSVKPPMFSCFGDIALAIGAHFERYVAPAVQIMQGAAQVCAQMDTLDEELMDYANQLRRSIFEAYSGIL
QGFKDTKAELMMPYAQHLLQFVELVSKDSLRDESVTKAAVAAMGDLADVVGENTKQLFKNFTF

DNA
ATGGAGAGGAATTACATCATGAAGATGGTATGCGAGACAGCATGTTCCAAGGAGGCAGAGATCAGACAAGCTGCTTTCGA
GTGCCTTGTGTCTATTGCGTCCACATACTACGAGGTGCTGGAGCAATACATGCCAACACTCTTTGAGCTCACATCGAATG
CTGTAAAGGGAGATGAAGAGAGTGTTGCCCTCCAAGCAATTGAGTTTTGGAGTTCCATCTGTGATGAAGAGATTGACCGT
CAAGAGTATGACAGTCCTGATAGTGGTGACTCATCCCCTCCCCACTCCTGTTTCATAGAGAAGGCTCTTCCCCATTTAGT
TCAAATGTTGCTAGAAACTCTGCTGAAGCAGGAAGAGGATCAGGACCATGACGACGATGTCTGGAACATATCTATGGCTG
GCGGGACATGCCTTGGCCTGGTTGCCAGAACGGTTGGAGATGGTATAGTCCCTCTTGTGATGCCTTTTGTTGAAAAAAAC
ATAAGTTCGCCAGATTGGCGAAGCCGGGAGGCAGCCACTTATGCTTTTGGATCAATTTTGGAGGGCCCAACAATTGATAA
GCTTGCCCCGATGGTTGCTGCTGGCTTGGAATTCCTCCTTAATGCAACCAAGGATGGGAATAACCATGTCAGGGATACAA
CTGCTTGGACTCTGAGCCGTATCTTTGAATTTTTGCACTCCCCAGACAGTGGCTTCTCTGTTATATCACCCGAAAACCTC
CCTAGAATTGTGAGTGTATTACTGGAATCAATTAAAGATGTGCCAAATGTTGCAGAGAAGGTCTGCGGAGCAATATACAA
TCTTGCACAGGGATATGAAGACTCTGGAGCAAACTCCTCTCTTCTCTCTCCTTATCTCACAGAAATCATCACACATCTGC
TTGCAGCTGCTGAGCGTACAGATGGGGCAGAGTCTAAGCTAAGAGGTGCTGCGTATGAAACCTTGAATGAGGTTGTCCGG
TGTTCAAACCTTTCAGAGGCCTCGAGCATCATAGCGCATCTCCTCCCTGCCATCATGAAAAAATTAGCTGAAACTATGGA
CCTCCCGATAATATCAACTGATGACCGTGAGAAACAGGCAGAACTCCAGGCTTCTCTGTGTGGTGTTCTCCAAGTCATAA
TCCAGAAGCTGAGTGGCAGGGAGGATACAAAACCCATCATAATGCAGAACGCAGATGACATCATGAGGCTGTTCTTAAGA
GTGTTTGGATGCCATAGTTCAAGTGTCCACGAAGAAGCCATGCTTGCAATCGGTGCTCTTGCCTATGCAACTGGAGCTGA
GTTTGTGAAATACATGCCCGAGCTTTTCAAATATCTCCAGATGGGGCTGCAGAACTTCGAAGAATACCAAGTCTGCTCAA
TCACCGTAGGAGTGATTGGTGACATATGCCGTGCCTTGGATGAAAAAATCCTACCTTTTTGCGATCAGATAATGGGTCTC
CTTATCCAAAACCTTCAAAGTGGTGCACTCCACAGATCGGTGAAGCCTCCAATGTTCTCATGCTTTGGAGACATTGCTCT
GGCGATTGGTGCTCATTTCGAAAGGTATGTTGCTCCAGCCGTTCAGATCATGCAAGGGGCTGCTCAGGTGTGTGCGCAGA
TGGACACCCTTGACGAGGAGCTTATGGATTATGCAAACCAACTCCGGAGAAGCATCTTTGAAGCATACTCCGGAATACTA
CAGGGGTTCAAGGATACAAAAGCCGAGCTCATGATGCCCTACGCTCAACATCTCTTGCAGTTTGTTGAACTAGTATCCAA
AGATTCCCTGAGGGATGAGAGCGTGACAAAAGCCGCGGTTGCAGCAATGGGTGATCTTGCGGATGTTGTAGGGGAGAACA
CGAAGCAGCTGTTCAAAAACTTCACCTTCT