Details for Lyrate rockcress Locus 16034816

Position : sca3 ( 5`- 2746094 .. 2745189 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034816

Protein [Map View]
MKEIQIPRKNFARSSDLGAKRLKDPEMKNRKITTEKRQSATFSDVSFESTKDSMDFTPISQISGPISDSEAESIIMQGSS
PDLLSTPKICLPADDSPVSTITSVEARIDTSSTDRIQSIVDLPASVQSLRAEINELKKLICSAENSAEINWVDGVVTMKF
RIVLLSFILWAILAAIVVFFSSGEEVAYRGLLPT*

DNA
ATGAAGGAAATTCAAATTCCCAGGAAAAACTTCGCGCGCTCATCAGATCTCGGAGCTAAGAGACTCAAGGACCCTGAGAT
GAAGAATCGAAAGATTACGACGGAGAAGAGACAGAGCGCAACATTTTCCGATGTATCTTTTGAAAGCACAAAGGATTCAA
TGGATTTTACTCCGATCTCTCAGATTTCTGGTCCGATCTCTGATTCCGAGGCTGAGAGTATTATTATGCAAGGATCGAGC
CCAGACTTATTGTCAACGCCTAAAATTTGTCTTCCGGCAGATGATTCTCCAGTTTCAACGATTACTAGTGTGGAGGCTCG
TATTGACACTTCTTCTACTGATCGGATCCAGTCGATTGTGGACTTGCCTGCTTCTGTGCAGTCCTTGCGTGCGGAGATCA
ATGAGCTAAAAAAACTGATCTGTTCGGCTGAAAATTCTGCAGAAATTAACTGGGTCGACGGAGTTGTTACTATGAAATTC
CGCATTGTGCTTTTGAGTTTCATCCTTTGGGCTATCTTAGCTGCGATTGTGGTCTTCTTCAGCTCAGGAGAGGAAGTTGC
TTACCGTGGACTACTTCCAACATGA