Details for Lyrate rockcress Locus 16034812

Position : sca3 ( 5`- 6473081 .. 6474022 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034812

Protein [Map View]
MLAIFQKTFAHPPEELNSPASHVSGETPKLPGETLSDFLSRHQNTAFSMNFGDSAVLAYARQETSLRQRLFCGLDGIYCM
FLGRLSNLCTLNRQYGLSGQNSNEAMFVIEAYRTLRDRGPYPADQVLRGLEGSFAFVVYDSQSSSVFSALSSDGGESLYW
GISGDGSVVMSDDIQIIKQGCAKSFAPFPTGCMFHSEKGLKSFEHPTNKMKAMARIDSEGVLCGANFKVDACSKIISIPR
RGSEANWALANSR*

DNA
ATGTTGGCAATATTTCAGAAAACTTTTGCTCACCCACCGGAAGAACTCAACAGTCCGGCGTCTCATGTTTCCGGCGAAAC
CCCTAAACTTCCCGGAGAAACTCTCTCCGACTTCCTCTCTCGTCACCAAAACACCGCTTTCTCCATGAACTTCGGCGATT
CCGCCGTCTTAGCTTACGCTCGCCAAGAAACCTCTCTCCGTCAGAGGTTGTTCTGTGGACTAGATGGGATCTACTGTATG
TTTCTAGGGAGATTGAGCAACCTCTGTACATTGAATCGACAATACGGTTTATCTGGGCAGAACTCAAACGAGGCAATGTT
TGTGATCGAAGCTTATCGAACACTTCGTGATCGTGGTCCTTATCCAGCTGATCAAGTCCTCAGAGGTCTTGAGGGAAGCT
TCGCTTTCGTTGTGTACGATTCTCAAAGCTCCTCTGTTTTCTCAGCTTTGAGTTCTGATGGAGGAGAGAGTCTTTACTGG
GGAATTTCTGGAGATGGATCTGTTGTAATGTCTGATGATATTCAGATCATAAAGCAAGGCTGTGCTAAATCATTTGCTCC
TTTCCCTACTGGGTGTATGTTTCATAGTGAGAAAGGGCTAAAGAGCTTTGAACATCCGACTAATAAGATGAAGGCAATGG
CGAGGATTGATAGTGAAGGTGTTCTTTGTGGAGCTAATTTCAAAGTTGATGCTTGTTCTAAGATCATTAGTATCCCTAGA
AGAGGAAGTGAAGCTAACTGGGCGCTGGCTAATTCTCGTTAA