Details for Lyrate rockcress Locus 16034808

Position : sca3 ( 5`- 22183157 .. 22183366 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034808

Protein [Map View]
MASNEAGRALPKFGEWDVNDPATADGFTVIFSKAGEDKKTGRSSTKTNSQRKQDGDKPAVKKWLCFTFT*

DNA
ATGGCATCGAATGAAGCTGGAAGGGCATTGCCGAAATTCGGGGAATGGGATGTGAATGATCCGGCGACAGCGGATGGATT
CACGGTGATATTTAGCAAAGCCGGTGAAGATAAAAAGACTGGACGGAGTTCGACGAAGACAAATTCTCAGAGGAAACAAG
ACGGTGATAAACCAGCGGTCAAGAAATGGCTCTGTTTCACTTTTACTTGA