Details for Lyrate rockcress Locus 16034807

Position : sca3 ( 5`- 8561631 .. 8562965 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034807

Protein [Map View]
MAVRCLFSPNLLNSKNKVSGNNHHLPFSSLSKKHQASSAAINGGGSSKTVKRLITLSPSEGKWNGNWNTQYDVSLRDLHL
QDLVEDGPPNSRVSVDLSVQRHASMGLSVDGRIMTSIARKCSICSSLYPRLIDTSFTVWILPSSRENRASTLPEIGGDDP
SVIYVRPGYEANLDSLVQDTIRLTTYAKDICSDSCEKSEPTLHYVGETNTASVHKRWSRLLELKKK*

DNA
ATGGCTGTACGTTGTTTGTTCTCTCCAAATCTCTTGAACTCCAAGAACAAAGTTTCCGGCAATAATCATCACCTTCCCTT
TTCTTCCCTCTCCAAGAAACACCAAGCTTCTTCCGCAGCCATTAATGGAGGAGGGAGCTCAAAAACAGTGAAGCGTCTGA
TCACTTTATCTCCTAGTGAAGGAAAATGGAATGGAAACTGGAACACTCAGTACGATGTCTCTCTGCGTGATCTTCACCTT
CAAGATCTTGTTGAAGATGGCCCTCCCAATTCCCGTGTCTCTGTCGACCTCTCTGTCCAAAGGCACGCGAGCATGGGCCT
CTCAGTAGATGGAAGAATCATGACTTCTATCGCAAGAAAGTGCAGCATTTGCTCTTCTCTTTATCCTCGACTGATTGATA
CAAGTTTCACTGTCTGGATTTTGCCATCAAGCCGGGAAAATCGAGCTTCAACACTGCCAGAAATTGGCGGCGATGATCCT
TCGGTAATATATGTGAGACCTGGATATGAAGCTAACCTTGATTCCCTTGTACAAGACACTATCCGACTCACAACTTATGC
TAAAGATATATGCTCCGATTCCTGCGAAAAATCGGAACCAACACTGCATTACGTTGGTGAGACAAATACAGCTTCTGTTC
ATAAGCGATGGTCAAGACTACTTGAGCTTAAGAAGAAGTAG