Details for Lyrate rockcress Locus 16034769

Position : sca3 ( 5`- 4542787 .. 4545959 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034769

Protein [Map View]
MSMTLNLQRHAKRILAYSNRPRLFCSYRNGTLSSPGTNQTLLSRIESAADQKAAITTVLEEWRQQQKHGNHQLNPSLVKG
IVEKLHDSKRYRQALEVSNWMIEKKICNHLPEDLAVRFHLIENVLGLEEAEKFFQSIPENLKGESIYTSLLKSYAKSGEI
SLRKAEYTFEKMRKLGMLLRPSPYNSMVSLYSSLRNRNKVDEILREMKENNLELDSPTVNNALRVYAAVCDVATMDKFLA
DWNAITTLEWLTTLEMAKAYRLIRLYGEAGEREDVYRIWDLYKNTKEKDNEGFRALIGSLLKLDDINGAEKIYYDEWESS
GLEFDLRIPTMLMSGYRAKGMVKKADKLLYKTMKNKRLVISINPFVEELVKNRNQVKPSDLRDLIKNLRDSNQLSKALEA
STWMCEKRGFNLFPEDYAIRFHLIEKVLGLEEAEKFFESSIPKNMKDYSVYDTLLTSYTRSDKTLVKAEGVFEKMRELGF
LSKLSPFNSIISLYIEQRKLSKVNKLLCDMKQNNIYRA*

DNA
ATGAGCATGACGCTTAATCTTCAGCGACACGCAAAGCGAATCCTCGCTTACAGTAACAGGCCTCGACTCTTCTGCTCCTA
CAGAAACGGAACCCTATCGTCTCCGGGGACGAACCAAACTCTGCTGAGTCGAATCGAATCGGCTGCTGATCAAAAAGCAG
CAATCACTACGGTGCTTGAGGAATGGAGACAACAGCAAAAACATGGGAATCATCAATTAAACCCTTCGTTGGTGAAAGGT
ATAGTCGAGAAGCTCCACGATTCCAAGAGATATCGTCAAGCCCTAGAGGTATCAAACTGGATGATTGAAAAAAAGATCTG
CAATCACCTTCCGGAAGATCTCGCAGTTCGATTTCATCTGATTGAGAACGTTTTGGGATTAGAAGAAGCAGAGAAGTTCT
TCCAAAGCATCCCGGAGAATCTGAAAGGTGAATCTATCTACACTTCTCTGTTAAAGAGTTACGCAAAATCGGGAGAAATA
TCTTTACGTAAAGCCGAATATACTTTCGAGAAGATGAGGAAGCTAGGTATGCTCTTGAGACCATCACCTTACAACTCCAT
GGTCTCACTCTACAGCTCTCTCAGAAACAGAAATAAGGTCGATGAGATTCTTCGAGAGATGAAGGAGAACAACCTTGAGC
TCGATAGTCCCACCGTGAACAACGCTTTACGAGTATACGCTGCTGTTTGTGATGTTGCGACAATGGACAAGTTTCTAGCT
GATTGGAATGCAATTACAACGCTTGAGTGGCTCACAACACTTGAAATGGCAAAGGCTTATAGACTCATAAGGCTATATGG
TGAAGCAGGGGAGAGAGAAGATGTGTACCGTATATGGGACTTGTACAAGAACACAAAAGAGAAGGACAATGAAGGATTTC
GAGCTTTGATTGGTTCTCTCTTGAAGCTTGATGATATCAACGGAGCAGAGAAGATATACTACGATGAGTGGGAGTCCTCT
GGTCTTGAGTTCGATCTCCGAATCCCGACTATGTTGATGTCTGGTTATCGCGCAAAGGGAATGGTGAAGAAGGCAGATAA
ACTATTGTACAAGACTATGAAGAATAAAAGATTGGTTATATCGATTAATCCGTTTGTTGAGGAATTGGTGAAAAATAGAA
ACCAAGTGAAGCCGTCGGACTTGAGAGACCTCATCAAGAATCTGCGTGACTCAAATCAATTATCTAAAGCACTTGAGGCA
TCAACATGGATGTGTGAAAAGAGAGGTTTTAATCTTTTTCCAGAAGATTATGCAATTAGGTTTCATCTGATTGAGAAAGT
GTTGGGATTGGAGGAAGCAGAGAAGTTTTTCGAAAGCAGCATCCCGAAGAACATGAAGGATTACTCTGTCTACGATACAC
TCTTAACCTCGTACACAAGATCTGACAAAACTCTAGTCAAAGCGGAAGGCGTTTTCGAGAAGATGAGAGAGCTAGGTTTC
CTCTCAAAACTTTCCCCATTCAACTCGATAATATCTCTCTACATTGAGCAAAGGAAACTAAGTAAGGTCAATAAGCTTCT
ATGTGATATGAAGCAGAATAATATATATAGAGCCTGA