Details for Lyrate rockcress Locus 16034763

Position : sca3 ( 5`- 7483185 .. 7482286 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034763

Protein [Map View]
MGVTERRVYGLVMVSMVLIAIATMCCVQATIEEEAAKDESWTDWAKEKIGLKHEDNIQPTHTTTTVQDDAWRASEKAEDA
KEAAKRKAEEAVGAAKEKVGSAYETATSKAGEGLGSLKEKASQGYDSAGQVKDDVSHKSKQVKDSLSGDENDESWTDWAK
EKIGIKNEDINSPNLGETVSEKAKDAKEAAKRKAGDAKEKLEETVEAAKEKASDMTSAAKEKAEKLKEEAERESKSAKEK
SKESYETAKSKADETLESAKDKAAQSYDSAAHKSEEAKDTVSHKSKRVKESLTDDDAEL*

DNA
ATGGGGGTAACAGAGAGAAGAGTGTACGGTTTGGTTATGGTATCTATGGTACTTATAGCTATTGCAACGATGTGTTGTGT
CCAAGCTACGATCGAGGAAGAAGCGGCTAAGGATGAATCATGGACTGATTGGGCCAAGGAAAAGATCGGTCTCAAGCACG
AAGACAACATCCAACCCACTCACACCACCACAACCGTCCAAGACGACGCTTGGAGAGCGAGTGAAAAAGCCGAGGACGCA
AAAGAGGCGGCTAAACGCAAAGCAGAGGAAGCGGTTGGAGCCGCAAAGGAGAAAGTGGGATCGGCTTACGAGACAGCTAC
ATCGAAAGCTGGCGAGGGTTTGGGTTCCCTGAAAGAGAAGGCCTCGCAGGGTTACGACTCGGCTGGTCAAGTTAAGGATG
ACGTGTCTCACAAGTCAAAACAAGTTAAAGATAGCTTGTCCGGAGATGAAAACGATGAGTCTTGGACTGATTGGGCCAAA
GAGAAAATCGGAATCAAGAACGAAGACATCAATAGCCCTAACTTGGGAGAGACGGTATCGGAGAAGGCTAAAGACGCTAA
GGAGGCTGCTAAACGCAAAGCGGGTGATGCTAAGGAGAAGTTGGAGGAAACGGTTGAGGCAGCGAAAGAGAAGGCGAGCG
ATATGACGAGTGCAGCTAAGGAGAAGGCAGAGAAGTTGAAGGAGGAAGCAGAGAGAGAGAGTAAGAGTGCGAAGGAGAAA
AGTAAGGAAAGCTACGAGACTGCGAAATCTAAAGCCGATGAGACTTTGGAGTCTGCAAAAGATAAGGCGGCGCAGAGTTA
TGACTCAGCTGCGCATAAATCGGAGGAAGCTAAAGATACCGTGTCACACAAGTCAAAACGTGTTAAAGAGAGCTTGACCG
ACGATGATGCTGAGCTCTAA