Details for Lyrate rockcress Locus 16034748

Position : sca3 ( 5`- 6032121 .. 6032348 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034748

Protein [Map View]
METVKTSRFITEVAPAKFISATREPFKNMLTTISEEDFDFDELVRATADRLSSSCPGSSSWSLAHYAKINRVSSS*

DNA
ATGGAAACAGTTAAGACCTCCAGGTTTATCACTGAGGTGGCTCCGGCTAAGTTTATATCGGCGACAAGAGAACCATTCAA
GAACATGTTGACAACCATCTCCGAGGAAGACTTTGATTTTGATGAATTAGTCAGAGCCACTGCAGATAGACTCTCTTCTT
CTTGTCCAGGCTCCTCCTCCTGGTCTCTTGCTCACTACGCCAAGATCAACAGAGTCTCTTCTTCTTAG