Details for Lyrate rockcress Locus 16034721

Position : sca3 ( 5`- 8055688 .. 8056121 -3` )
Annotation : [B2G] 60s ribosomal protein l30
External links : CoGe
PGDD synteny : 16034721

Protein [Map View]
MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAMLAKVGVHHYNGNNVD
LGTACGKYFRVSCLSIVDPGDSDIIKALPGDQ*

DNA
ATGGTTGCGGCGAAGAAGACGAAGAAGTCCCATGAGGGAATCAACAGCAGATTAGCTCTTGTGATGAAGAGTGGAAAGTA
CACTCTCGGATACAAATCTGTTCTCAAATCCCTTCGCAGCTCCAAAGGTAAGCTGATATTGATATCTAGCAATTGCCCAC
CATTGAGGAGATCAGAGATTGAATACTATGCCATGCTTGCTAAAGTTGGAGTTCATCACTACAATGGTAACAATGTTGAT
TTGGGTACTGCTTGTGGTAAATACTTCCGAGTCTCTTGCCTCAGCATCGTTGATCCTGGTGATTCCGACATCATCAAGGC
ACTTCCTGGAGATCAGTGA