Details for Lyrate rockcress Locus 16034710

Position : sca3 ( 5`- 22146497 .. 22145557 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034710

Protein [Map View]
MKGGESKAEATSTDQRLKTRGRKPGKKTKKDPNQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKSMTEE
DKAPYVAKAESRKTEYLKTMQQYNMKLASGTNRGEEDDSDKSKSEVDEAGSEEVFMQEEEDDD*

DNA
ATGAAAGGCGGCGAATCCAAAGCTGAAGCTACGAGCACTGATCAGAGACTCAAAACCAGAGGTAGAAAGCCTGGGAAGAA
GACGAAGAAGGATCCAAATCAACCTAAGAGACCTCCAAGTGCTTTCTTCGTCTTCCTTGAGGATTTCCGAAAAGAGTTTA
ACCTAGCGAATCCGAATAACAAATCCGTCGCTACTGTTGGTAAGGCTGCTGGAGCTAGATGGAAGTCTATGACTGAGGAA
GATAAAGCGCCTTACGTCGCCAAGGCCGAGAGCAGAAAGACTGAATATCTTAAGACTATGCAACAGTACAACATGAAACT
GGCTAGTGGAACCAATAGAGGTGAAGAGGATGACTCTGACAAATCCAAGTCTGAAGTGGACGAAGCAGGAAGCGAAGAGG
TTTTTATGCAGGAGGAGGAAGACGACGATTGA