Details for Lyrate rockcress Locus 16034681

Position : sca3 ( 5`- 4115992 .. 4117781 -3` )
Annotation : [B2G] transcription initiation factor iib-2
External links : CoGe
PGDD synteny : 16034681

Protein [Map View]
MSDAFCSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLTTVISKPN
GSSGDFLSSSLGRWQNRGSNPDRGLIVAFKTIATMADRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACR
QEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEEF
DIRRSPISIAAAVIYIITQLSDEKKPLRDISVATGVAEGTIRNSYKDLYPHLSKIIPAWYAKEEDLKNLQSP*

DNA
ATGAGTGACGCGTTTTGTTCGGACTGTAAGAGGCACACGGAGGTTGTGTTTGACCATTCCGCCGGAGATACAGTTTGTTC
AGAGTGTGGGCTCGTTCTTGAATCGCACTCAATCGATGAAACTTCGGAGTGGCGTACCTTCGCTAATGAGTCCGGTGATA
ATGATCCAGTTCGTGTCGGTGGTCCGACGAATCCTCTTTTAGCTGATGGTGGTCTCACTACTGTCATTTCCAAACCTAAT
GGATCCTCTGGCGATTTCCTCTCTTCTTCTCTTGGTCGATGGCAGAATCGTGGATCTAATCCCGATCGTGGCCTTATTGT
TGCTTTCAAGACTATCGCTACCATGGCTGATAGGTTGGGACTTGTCGCCACCATCAAGGACCGAGCGAATGAGATTTATA
AAAGGGTAGAGGATCAGAAGTCAAGTAGAGGAAGAAATCAGGATGCTCTTTTGGCTGCCTGTTTATACATTGCTTGCCGG
CAAGAAGACAAGCCACGAACCGTCAAGGAAATATGCTCTGTTGCCAATGGAGCTACTAAGAAGGAGATCGGTCGTGCAAA
AGAGTACATAGTCAAACAGTTGGGGCTGGAAACCGGACAATCGGTTGAAATGGGTACTATACATGCTGGAGATTTTATGA
GACGTTTTTGCTCCAATCTTGGTATGACCAACCAAACCGTGAAAGCTGCTCAAGAATCTGTGCAAAAGTCAGAGGAATTT
GATATAAGGAGGAGTCCCATATCGATTGCAGCAGCGGTGATATACATCATAACACAGCTCTCTGATGAGAAGAAGCCTCT
CCGAGATATATCTGTGGCAACTGGAGTCGCGGAAGGAACTATAAGAAACTCTTACAAAGATCTTTACCCTCACCTTTCGA
AGATCATACCAGCTTGGTACGCTAAAGAAGAAGATCTCAAGAACCTTCAAAGCCCTTGA