Details for Lyrate rockcress Locus 16034671

Position : sca3 ( 5`- 3479319 .. 3477262 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034671

Protein [Map View]
MSIVTVPSSTSKVQQIKTLISVASTFNHLKQVHVSLIHHHLHHDTFLVNLLLKRTLFFRQTHYSFLLFSHTQFPNIFLYN
TLINGFVNNHLFHETLDLFLSIRKHGLNLHGFTFPLVLKACTRASNRKLGIDLHSLVVKCGFNHDVAAMTSLLSIYSGSG
RLNDAHKVFEEIPERSVVTWTALFSGYTTAGKHREAIDLFKKMVEMGVRPDSYFIVQVLSACVHVGDLDSGEWIVKHMEE
MEMQKNSFVRTTLVNLYAKCGKMEKARSVFDSMGEKDIVTWSTMIQGYASNSFPKEGIEFFLQMLQENLKPDQFSIVGFL
SSCASLGALDLGEWGISLIDRHEFLTNLFMANALIDMYAKCGAMARGFEVFKEMKEKDIVIMNAAISGLAKNGHVKLSFA
VFGQTEKLGISPDGSTFLGLLCGCVHAGLIQDGLRFFNAISCVYALKRTVEHYGCMVDLWGRAGMLDDAYRLICDMPMRP
NAIVWGALLSGCRLVKDTQLAETVLKELIALEPWNAGNYVQLSNIYSVSGRWDEAAEVRDMMNRKGMKKIPGYSWIELEG
TVHEFLADDKSHPLSDKIYAKLEDLGNEMRLMGFVPTTEFVFFDVEDEEKERVLGHHSEKLAVAFGLISTDHGQVIRVVK
NLRVCGDCHEVMKLISKITRREIVVRDNNRFHCFTNGSCSCNDYW*

DNA
ATGAGCATCGTCACCGTCCCATCATCAACATCAAAAGTCCAGCAAATCAAAACCCTAATCTCCGTCGCATCCACCTTCAA
TCATCTGAAACAAGTCCACGTCTCTCTCATTCACCACCATCTCCACCACGACACCTTCCTCGTCAACCTCCTCCTCAAGC
GAACTCTCTTCTTCCGCCAAACCCATTACTCCTTTCTCCTCTTCTCTCATACCCAATTCCCCAACATTTTCCTCTACAAT
ACTCTCATCAATGGCTTCGTCAACAATCATCTCTTCCATGAAACCCTCGATCTCTTCCTCTCCATCCGCAAACATGGTCT
CAACCTCCATGGTTTCACCTTCCCTTTGGTTCTCAAGGCCTGCACCAGAGCCTCGAATCGCAAGCTTGGGATTGATCTTC
ATTCCCTTGTGGTCAAATGTGGGTTTAATCACGATGTGGCCGCTATGACGAGCCTGCTTTCTATCTACTCTGGATCCGGG
CGTTTGAATGATGCCCACAAAGTGTTCGAGGAAATTCCTGAGAGAAGCGTTGTAACTTGGACGGCTTTGTTTAGTGGGTA
TACGACTGCCGGAAAGCACAGGGAAGCCATTGATTTGTTTAAGAAGATGGTGGAAATGGGTGTGAGACCGGATAGTTACT
TTATTGTTCAGGTTTTATCTGCTTGTGTTCATGTAGGGGATCTTGACAGCGGGGAGTGGATAGTTAAGCATATGGAAGAG
ATGGAGATGCAGAAGAATTCCTTTGTGCGCACAACACTTGTCAATCTCTATGCCAAGTGTGGGAAGATGGAGAAAGCCCG
TTCTGTGTTCGACTCGATGGGGGAGAAAGATATAGTTACTTGGAGCACTATGATACAAGGGTATGCATCGAACAGCTTCC
CGAAAGAAGGAATAGAGTTCTTTCTTCAGATGTTGCAAGAAAATCTGAAACCGGACCAGTTTTCCATTGTCGGGTTTCTT
TCTTCTTGTGCAAGCTTAGGAGCGCTTGATCTAGGTGAATGGGGAATTAGTTTAATAGATAGGCATGAGTTCTTGACCAA
TCTGTTTATGGCCAATGCGCTGATAGACATGTATGCGAAATGTGGGGCTATGGCTCGAGGTTTTGAAGTATTCAAAGAAA
TGAAGGAGAAAGATATAGTTATCATGAATGCTGCAATTTCTGGTCTGGCCAAGAATGGCCACGTTAAGCTCTCATTTGCG
GTTTTTGGACAAACAGAGAAGTTAGGTATCTCCCCTGATGGGTCCACGTTCCTTGGACTGCTCTGTGGGTGCGTTCACGC
AGGCCTAATCCAAGACGGGCTTCGGTTTTTTAACGCCATAAGCTGTGTTTACGCTTTGAAACGCACGGTTGAGCACTATG
GTTGCATGGTAGATCTTTGGGGCAGAGCAGGAATGTTAGATGACGCATACCGTTTGATCTGCGATATGCCCATGAGGCCA
AATGCGATAGTCTGGGGAGCGTTACTGAGCGGATGCAGACTGGTCAAAGATACGCAGTTAGCAGAAACTGTTCTCAAAGA
ACTCATCGCTTTGGAGCCATGGAATGCAGGAAACTATGTTCAGTTATCCAACATATACTCTGTCAGTGGCAGATGGGACG
AAGCGGCTGAAGTGAGGGACATGATGAACAGGAAAGGTATGAAGAAGATCCCGGGATATAGTTGGATCGAGTTGGAAGGG
ACGGTCCATGAGTTTCTAGCAGATGATAAATCGCATCCTCTTAGCGACAAGATATATGCAAAGCTAGAAGATTTGGGTAA
TGAAATGAGGCTTATGGGGTTTGTTCCAACGACAGAGTTTGTTTTCTTCGATGTTGAAGATGAAGAAAAAGAAAGGGTCT
TGGGGCATCACAGCGAGAAGCTTGCGGTTGCGTTTGGGCTGATCAGTACGGATCATGGCCAAGTGATTCGGGTGGTGAAG
AATCTAAGGGTATGTGGAGATTGTCATGAAGTGATGAAGTTGATATCGAAGATCACAAGACGAGAGATCGTTGTTAGAGA
CAACAATAGGTTTCATTGTTTTACAAATGGCTCTTGTTCTTGCAATGACTACTGGTGA