Details for Lyrate rockcress Locus 16034668

Position : sca3 ( 5`- 6124903 .. 6126040 -3` )
Annotation : [B2G] 60s ribosomal protein l18a
External links : CoGe
PGDD synteny : 16034668

Protein [Map View]
MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIW
LRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRP
PTRKLKTTYKASKPNLFM*

DNA
ATGGGTGCTTTCCGGTTTCACCAATATCAAGTGGTTGGGAGAGCCCTCCCGACAGAGAAAGATGAGCACCCTAAGATCTA
CAGGATGAAGCTTTGGGGTAGAAATGAAGTATGCGCCAAGTCCAAGTTTTGGTACTTCATGAGGAAATTGAAGAAGGTCA
AGAAAAGCAACGGACAGATGCTTGCCATCAATGAGATTTTCGAGAAGAATCCCACGACAATCAAGAATTACGGTATCTGG
CTGCGTTATCAGAGCCGAACTGGGTACCACAACATGTACAAGGAGTACCGTGACACGACACTCAATGGTGGAGTGGAGCA
GATGTACACTGAGATGGCTTCTCGTCATAGAGTGAGGTTCCCTTGCATTCAGATCATCAAGACTGCAACAGTCCCTGCAA
AGCTGTGCAAGAGAGAGATCACCAAGCAGTTCCACAACTCGAAGATCAAGTTCCCTCTTGTTTTCAGAAAGGTCAGACCA
CCAACCAGGAAGCTGAAGACTACATACAAGGCATCAAAGCCTAACCTTTTCATGTAG