Details for Lyrate rockcress Locus 16034618

Position : sca3 ( 5`- 4814415 .. 4811752 -3` )
Annotation : [B2G] prenyltransferase [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034618

Protein [Map View]
MELSISQSPCVRFSSLAPRFLAASHHHRSSVHLAGKFISLPRDVSFTSLSTSRMRSKFVSTNYRKISIQACSQVGAAGTD
PVLDRITRFQNACWRFLRPHTIRGTALGSTALVARALIENTHLIKWSLVLKALSGLLALICGNGYIVGINQIYDIGIDKV
NKPYLPIAAGDLSVQSAWLLVIFFAIAGLLVVGFNFGPFITSLYSLGLFLGTIYSVPPLRMKRFPIAAFLIIATVRGFLL
NFGVYHATRAALGLPFQWSAPVAFITSFVTLFALVIAITKDLPDVEGDRKFQISTLATKLGVRNIAFLGSGLLLVNYVSA
ISLAFYMPQVFRGSLMIPAHLILASCLIFQTWVLEKANYTKEAISGYYRFIWNLFYAEYLLFPFL*

DNA
ATGGAGCTCTCGATCTCGCAATCACCGTGTGTTCGGTTCTCGTCTCTGGCGCCTCGTTTCTTAGCAGCTTCTCATCATCA
TCGTTCTTCTGTGCATTTAGCTGGGAAGTTTATAAGCCTCCCTCGAGATGTTAGCTTCACGAGCTTATCAACTTCAAGAA
TGCGGTCCAAATTTGTTTCAACCAATTATAGAAAAATCTCGATCCAGGCATGTTCTCAGGTTGGTGCTGCTGGGACTGAT
CCAGTGCTGGATAGAATTACCCGGTTCCAAAATGCTTGCTGGAGATTTCTTAGGCCCCATACAATCCGTGGAACAGCTTT
AGGATCCACCGCCTTGGTGGCAAGAGCTTTGATAGAGAATACTCATCTGATCAAATGGAGTCTTGTACTCAAGGCACTTT
CAGGTCTTCTTGCTCTTATATGTGGGAATGGTTATATAGTCGGCATCAATCAGATCTACGACATTGGTATCGACAAAGTG
AACAAACCATATTTGCCAATAGCAGCAGGAGATCTCTCAGTGCAGTCTGCCTGGTTGTTAGTGATATTTTTTGCGATAGC
AGGGCTTTTAGTTGTCGGATTTAACTTTGGTCCATTCATTACAAGCCTATACTCTCTTGGCCTTTTTCTGGGAACCATCT
ATTCTGTTCCACCGCTTAGAATGAAAAGATTCCCAATTGCAGCATTTCTTATTATTGCCACGGTACGAGGTTTCCTTCTT
AACTTTGGTGTGTACCATGCTACAAGAGCTGCTCTTGGACTTCCATTTCAGTGGAGTGCCCCTGTGGCGTTCATCACATC
TTTTGTGACACTGTTTGCACTGGTCATTGCTATTACAAAAGATCTTCCTGATGTTGAAGGAGATCGCAAGTTCCAAATAT
CAACCCTGGCAACAAAACTTGGAGTGAGAAACATAGCATTCCTCGGTTCTGGACTTCTGCTAGTGAACTATGTTTCCGCC
ATATCACTAGCTTTCTACATGCCTCAGGTTTTCAGAGGTAGCTTGATGATTCCTGCACATCTGATCTTGGCTTCATGCTT
AATTTTCCAGACATGGGTACTAGAAAAAGCAAACTACACCAAGGAAGCTATCTCAGGATATTATAGGTTTATATGGAATC
TCTTCTACGCAGAGTATCTGTTATTCCCCTTCCTCTAG