Details for Lyrate rockcress Locus 16034477

Position : sca3 ( 5`- 22302831 .. 22301932 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_480687 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034477

Protein [Map View]
MEDQSAARYIGKVNWFGDGKGYGFITPDDGGEELFVHQSSIVSDGYRSLTVGESVEYSITLGSDGKTKAVNVTAPGGGSL
NKKENSSRGNGGSCFNCGEVGHMAKDCDGGGGGRSYGGGGGRRSGGEGTCYVCGDVGHFARDCRQSGGGNSGGGGGGGPC
YSCGEVGHLAKDCRGGSGGNRYGGGGRGSGSDGCYLCGGVGHFARDCRQNGGGNVGGGGGGGNTCYTCGGVGHIARVCTS
KRPSGGACYECGETGHLARDCDRRGSGSSGGGGGGGGGSGKCFNCGKEGHFARECSSVA*

DNA
ATGGAAGATCAATCGGCGGCGAGATATATCGGAAAAGTCAATTGGTTTGGCGATGGTAAAGGCTACGGTTTCATTACTCC
CGATGATGGAGGCGAAGAGCTTTTTGTTCATCAATCTTCAATCGTTTCCGATGGTTACCGTAGCTTAACTGTTGGTGAAT
CGGTTGAATACTCAATCACGCTTGGAAGCGACGGGAAGACTAAGGCCGTTAATGTTACTGCTCCTGGCGGCGGTTCTCTT
AATAAGAAGGAAAATAGCTCCCGCGGAAACGGTGGTAGTTGTTTTAATTGCGGTGAGGTTGGTCATATGGCTAAGGATTG
TGACGGTGGTGGTGGTGGGAGAAGCTATGGAGGTGGTGGTGGTCGTAGATCTGGCGGTGAAGGTACCTGTTACGTGTGTG
GTGATGTGGGACACTTCGCTAGGGATTGTAGGCAAAGCGGCGGTGGAAACAGTGGTGGAGGAGGAGGTGGTGGTCCGTGT
TATAGTTGCGGAGAGGTTGGTCATTTGGCAAAGGATTGTCGTGGTGGTTCTGGTGGGAATAGATACGGAGGTGGTGGTCG
TGGATCTGGCAGTGATGGATGCTACCTGTGTGGTGGTGTTGGACATTTCGCTAGGGATTGTAGGCAAAATGGTGGTGGGA
ACGTTGGAGGTGGTGGCGGCGGTGGAAACACATGTTATACATGTGGCGGAGTTGGCCACATTGCGAGAGTTTGCACCAGC
AAGAGACCTTCTGGTGGTGCTTGTTACGAATGTGGAGAAACTGGCCATTTGGCTCGTGACTGTGATCGGAGAGGAAGCGG
AAGCAGCGGTGGTGGAGGTGGAGGTGGCGGTGGCAGTGGCAAGTGCTTCAATTGCGGCAAGGAAGGTCACTTTGCTAGGG
AATGTTCTTCGGTTGCTTAA