Details for Lyrate rockcress Locus 16034317

Position : sca3 ( 5`- 4501554 .. 4499345 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478461 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034317

Protein [Map View]
MAASNVRSSSSFSRNISVVSSPQIPGLKSGPNGTAFISTGIRDLDRILGGGYPLGSLVMVMEDPEAPHHMDLLRTFMSQG
LVNNQPLLYASPSKDPRGFLGTLPHPASSKEDKSTAPDPDQGESLRIAWQYRKYLESQKNSIDDYSNDFDMRKPLERQFL
SGRPIDCVSLLDSSDLSVAQDHCSTFLSKFSRSSSNIASIGRIAIQSFSSPLCEYSDKESDMLSFIRLLKSMLMVSNAVA
IVTFPPSLLSPSSSKRLQHMADTLLSIKAIPDGDKELEKLLTGYKDINGFLNIHKVARINTQVPVILEAKTFSMSLKKRR
FLALECLNQAPVDGSSGTSYGTSGSCSSKSGALDF*

DNA
ATGGCTGCATCAAACGTTCGTAGTAGTAGCAGCTTCTCTCGCAACATATCAGTTGTGTCATCGCCTCAAATTCCTGGTCT
CAAAAGTGGTCCTAATGGCACAGCTTTTATATCGACTGGGATTCGTGATCTTGACAGGATACTAGGTGGTGGGTATCCTT
TGGGAAGCTTAGTAATGGTGATGGAAGATCCTGAAGCACCGCATCATATGGATCTGTTAAGAACTTTCATGTCTCAGGGG
CTTGTTAACAATCAACCACTTCTTTATGCTAGTCCTTCGAAAGATCCGAGAGGGTTTCTTGGCACTTTGCCGCATCCTGC
ATCATCCAAAGAGGATAAGTCTACTGCGCCAGACCCTGATCAGGGAGAGAGCTTGAGGATCGCTTGGCAGTATCGGAAGT
ATTTGGAAAGCCAGAAGAATTCTATTGATGATTACTCAAATGACTTTGATATGAGAAAGCCCTTGGAGAGGCAATTTCTT
AGCGGACGGCCGATAGATTGTGTCAGCCTGTTAGATTCTTCAGATCTTTCCGTTGCTCAAGACCACTGCTCTACCTTTTT
ATCAAAATTTTCAAGAAGCAGCAGTAACATTGCATCCATTGGTCGCATCGCAATCCAGTCATTCAGCTCTCCCTTGTGTG
AGTATTCTGATAAGGAATCAGACATGCTCTCGTTCATAAGATTGCTGAAAAGTATGCTCATGGTTTCAAATGCGGTAGCC
ATTGTTACTTTCCCGCCTTCTTTGCTCTCACCATCTTCCTCAAAAAGACTGCAGCATATGGCAGATACCTTGCTCTCTAT
CAAAGCAATTCCAGATGGTGACAAGGAATTGGAGAAACTCCTCACAGGCTACAAGGATATAAATGGATTCCTCAACATAC
ACAAGGTTGCTCGTATCAACACACAGGTGCCTGTAATTCTTGAGGCAAAAACCTTCTCAATGAGCCTGAAGAAGAGAAGA
TTCTTGGCCCTAGAGTGTCTGAATCAAGCCCCTGTAGACGGGTCCAGTGGAACATCATATGGCACATCTGGTAGCTGCTC
ATCCAAATCCGGAGCACTCGATTTTTGA