Details for Lyrate rockcress Locus 16034315

Position : sca3 ( 5`- 1703471 .. 1744295 -3` )
Annotation : [B2G] zeta-carotene desaturase precursor
External links : CoGe
PGDD synteny : 16034315

Protein [Map View]
MASSIVFAATPATGFLSQPSLKSRRFYVNSSLDSDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLD
QGHEVDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGADKNLLVKDHTHTFINKDGTVGELDFRFS
VGAPIHGIRAFLVTNQLKPYDKLRNSLALALSPVVKALVDPDGAMRDIRNLDSISFSDWFLSKGGTRASIQRMWDPVAYA
LGFIDCDNMSARCMLTIFSLFATKTEASLLRMLKGSPDVYLSGPIKQYITDRGGRIHLRWGCREILYDKSADGETYVTGL
AISKATNKKIVKADVYVAACDVPGIKRLLPKEWRESRFFNDIYELEGVPVVTVQLRYNGWVTELQDIELSRQLKRAVGLD
NLLYTPDADFSCFADLALASPADYYIEGQGTLLQCVLTPGDPYMRMPNDKIIEKVAMQVTELFPSSRSLEVTWSSVVKIA
QSLYREAPGKDPFRPDQKTPIKNFFLAGSYTKQDYIDSMEGATLSGRQASSYICDTGEELAELNKKLSSSATAVPDELSL
V*

DNA
ATGGCTTCTTCAATCGTCTTCGCCGCAACTCCGGCTACTGGGTTTCTCTCCCAGCCTTCATTGAAGTCTCGGAGATTTTA
TGTTAATTCTTCACTCGACTCCGATGTTTCCGACATGAGTGTTAACGCTCCAAAGGGGTTATTTCCTCCAGAGCCTGTAC
CATACAAGGGACCTAAGCTGAAAGTAGCTATCATAGGAGCTGGACTTGCAGGCATGTCAACTGCTGTAGAGCTTCTCGAT
CAGGGTCACGAGGTGGATATATATGATTCTAGGACATTCATTGGTGGCAAAGTGGGTTCTTTTGTAGATAGACGTGGGAA
CCATATTGAAATGGGATTACATGTATTCTTCGGATGCTACAACAATCTTTTCCGCTTGATGAAGAAGGTGGGTGCTGATA
AAAACCTTCTTGTCAAAGACCATACTCATACATTTATAAACAAAGACGGGACAGTTGGAGAGCTTGATTTTCGGTTTTCT
GTTGGAGCTCCAATTCATGGTATTCGCGCATTTTTGGTCACAAATCAGCTCAAGCCCTATGATAAACTAAGGAATTCACT
GGCTCTTGCATTAAGCCCAGTTGTAAAAGCTCTCGTCGACCCCGATGGAGCAATGAGAGACATTCGCAATCTTGACAGCA
TAAGTTTCTCGGATTGGTTCCTGTCAAAAGGTGGGACAAGGGCAAGTATCCAGAGAATGTGGGATCCTGTTGCTTATGCA
CTCGGTTTTATAGACTGTGATAACATGAGTGCACGATGCATGCTTACCATATTCTCATTATTCGCCACCAAAACAGAAGC
TTCTTTGTTGCGTATGCTCAAGGGCTCGCCTGATGTTTACTTGAGTGGTCCTATCAAACAATATATCACAGATAGAGGTG
GCAGAATCCATCTAAGGTGGGGTTGCAGGGAGATACTTTATGATAAATCAGCAGATGGAGAAACTTATGTCACTGGACTA
GCAATTTCTAAGGCTACGAACAAGAAGATTGTGAAAGCTGATGTGTATGTTGCAGCATGTGATGTGCCAGGAATCAAAAG
GTTACTTCCAAAAGAATGGAGGGAATCTCGGTTTTTCAACGATATATATGAACTCGAGGGAGTACCTGTTGTCACAGTAC
AGCTCAGATACAATGGTTGGGTCACGGAGTTACAGGACATTGAACTTTCCAGGCAGTTGAAACGAGCGGTTGGCTTAGAT
AACCTTCTTTACACTCCTGATGCTGATTTCTCGTGCTTTGCTGATCTTGCACTCGCTTCGCCTGCAGATTATTACATCGA
AGGACAAGGCACTTTACTTCAGTGCGTTCTAACACCGGGAGATCCGTACATGCGAATGCCGAACGATAAGATCATAGAGA
AAGTAGCGATGCAGGTCACTGAGTTGTTTCCATCGTCACGGAGCCTAGAAGTCACTTGGTCATCGGTTGTAAAAATCGCT
CAGTCTCTGTACCGTGAAGCACCCGGAAAAGATCCATTCAGACCGGATCAGAAGACGCCCATAAAGAATTTCTTCCTCGC
TGGTTCATACACAAAACAGGATTACATAGATAGTATGGAAGGAGCGACATTATCAGGGAGACAAGCTTCGTCATACATCT
GTGATACCGGTGAAGAACTAGCAGAGCTAAACAAGAAGCTTTCTTCTTCTGCAACTGCAGTTCCTGATGAGCTAAGTCTG
GTCTAA