Details for Lyrate rockcress Locus 16034281

Position : sca3 ( 5`- 8216026 .. 8218680 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034281

Protein [Map View]
MVSDLDLVTRLREILGSSDLNTATPASVRRQLEADFGIDLTDKKAYIRDQIDTFLESNGAVEDKPESSKPEEDINAEEIK
AEIEGGDGEDLDGDGSESEEEKEERPVKAKKRGGGFTKVSQLSPQLEKVVGASQLGRTEVVKKMWAYIRENDLQDPKDRR
KIVCDELLHSLFRVKTINMFQMSKALTKHIWPLGDGDGCANNVKEEDEEEASEGTDKKGDQSEEVEENKEEESEEEEVRS
LRKRKRKKPAKSVEKPKRKGGGGFAKVCSLSPELQAFTGVTELARTEVVKMLWKYIKENNLQDPNDKRIIICDESLRSLF
PFESINMFQMSKLLTKHIWPLEDNAGESVSSNSPKNGKQKMESDGDSEEPNEKDKKQKKEVLAPLPLSVALVKFLGNNGE
SSLSRADVGKRLWEYIKQNDLQDPSDKRRIICDEKLKELFEVDSFEDTSFSTLLTNHFIKAEQ*

DNA
ATGGTTTCCGACTTGGACCTCGTGACCCGACTCCGTGAGATTCTCGGTAGCTCCGACCTAAACACGGCGACTCCGGCTAG
CGTCCGTCGTCAGCTGGAGGCGGATTTTGGTATCGACTTGACAGATAAAAAAGCCTATATTAGGGATCAAATCGATACTT
TTCTCGAGAGCAATGGCGCTGTAGAAGACAAACCTGAGAGCTCTAAGCCAGAAGAAGACATTAATGCCGAAGAAATCAAG
GCGGAAATTGAAGGAGGCGATGGAGAAGACCTAGACGGAGATGGAAGTGAAAGTGAGGAAGAGAAGGAAGAACGGCCAGT
AAAGGCCAAGAAACGAGGTGGTGGCTTTACCAAAGTATCTCAGTTATCTCCACAACTTGAGAAAGTTGTTGGAGCATCTC
AGTTAGGTCGAACCGAGGTTGTGAAGAAAATGTGGGCCTATATCCGAGAGAACGATTTGCAAGACCCAAAGGATAGGAGG
AAGATAGTGTGTGACGAGTTGCTGCATTCCTTGTTCCGTGTAAAGACCATTAATATGTTTCAAATGAGCAAGGCATTAAC
CAAGCATATTTGGCCCTTAGGTGATGGAGATGGGTGTGCGAACAATGTGAAAGAAGAAGATGAAGAGGAGGCATCAGAGG
GAACAGATAAGAAAGGGGATCAAAGCGAAGAAGTGGAAGAGAATAAAGAAGAAGAAAGTGAAGAGGAGGAAGTTAGGAGT
TTGCGGAAACGCAAGAGAAAAAAGCCTGCCAAGTCGGTAGAGAAGCCCAAAAGAAAAGGAGGAGGTGGCTTTGCTAAAGT
TTGCAGCCTCTCGCCGGAGCTTCAGGCATTTACTGGGGTGACAGAATTAGCCAGGACCGAGGTTGTGAAAATGCTTTGGA
AGTACATAAAGGAGAACAATTTGCAAGATCCGAATGATAAACGCATAATAATATGCGACGAATCATTGCGATCTTTATTC
CCTTTCGAGTCCATCAATATGTTTCAAATGAGTAAACTGCTAACAAAGCACATATGGCCTTTAGAGGATAATGCAGGAGA
ATCTGTTAGCTCTAACTCTCCAAAGAATGGAAAGCAAAAAATGGAATCAGATGGAGATAGTGAGGAACCAAATGAGAAAG
ATAAAAAGCAGAAGAAAGAAGTTCTTGCTCCCCTTCCACTTTCAGTTGCTCTTGTCAAGTTCTTGGGTAATAATGGAGAA
AGCTCGCTGTCAAGGGCGGATGTGGGAAAGAGATTGTGGGAGTACATAAAACAGAATGATCTTCAGGATCCTTCTGACAA
GAGGAGAATCATATGTGATGAGAAGCTGAAAGAACTCTTCGAAGTTGATTCATTCGAAGACACGTCGTTCTCAACACTTC
TGACCAACCACTTCATCAAGGCCGAACAATGA