Details for Lyrate rockcress Locus 16034268

Position : sca3 ( 5`- 2257388 .. 2256554 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034268

Protein [Map View]
MAWTRLIQSARAALGTTHSSSTLGLPRFYSKPATYFVKVGIPEFLGGIGRGAETHIAKIETEIGDLHKLLVTRTLRLKKL
GIPCKHRKLILNYGQKYRLGLWKPRADAIKS*

DNA
ATGGCGTGGACACGACTGATTCAGAGCGCGAGAGCAGCTCTAGGGACAACGCACTCGAGTTCGACTCTTGGCCTCCCCAG
ATTCTACTCCAAACCAGCTACTTATTTCGTGAAGGTTGGGATTCCAGAGTTTCTAGGCGGGATTGGCAGAGGAGCTGAGA
CTCACATTGCCAAAATTGAAACTGAGATTGGTGACCTTCATAAGCTGCTTGTGACGCGTACCCTCAGACTCAAGAAGCTT
GGCATTCCTTGCAAACATAGGAAACTTATACTCAACTATGGCCAGAAATACAGGTTGGGGCTATGGAAACCTAGAGCTGA
CGCTATTAAGTCCTGA