Details for Lyrate rockcress Locus 16034264

Position : sca3 ( 5`- 11023337 .. 11023750 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034264

Protein [Map View]
MRCATSFVVLCILMFLVLNNVKVDVKAQRRKPLCKMTGLLTPGKCPITIHDASNLCNRQLASPDRTFKRCDCQNTIKWRG
KDHYQCTCYLRLPCNE*

DNA
ATGAGGTGTGCTACATCGTTTGTAGTTTTGTGTATTCTCATGTTCCTTGTGTTAAACAATGTTAAAGTAGATGTGAAAGC
ACAACGACGGAAACCTCTGTGTAAAATGACTGGTCTTCTAACCCCTGGAAAATGCCCCATAACTATCCATGATGCAAGCA
ACTTGTGTAATCGCCAATTGGCGTCGCCTGATAGGACATTTAAGCGTTGCGACTGTCAAAACACTATTAAATGGCGAGGG
AAAGACCACTATCAATGCACATGTTATCTGAGACTCCCTTGCAACGAATAG