Details for Lyrate rockcress Locus 16034259

Position : sca3 ( 5`- 8789937 .. 8790281 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_898417 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034259

Protein [Map View]
MRDPDYWEDPDEFKPERFLLASSSRSRQDDERREKALKYIPFGGGRRGCPGENLAYVILGNVVGMMVQGFEWRNEGAKVD
LEESIKGLTLTMAHPPKFTPVGRTSDPLNLNQQS*

DNA
ATGAGAGATCCAGATTACTGGGAAGATCCTGATGAGTTTAAGCCAGAGAGGTTTCTTCTAGCTTCGTCTTCAAGATCAAG
GCAAGATGATGAGAGAAGAGAGAAAGCACTCAAGTACATTCCATTCGGCGGCGGAAGGAGAGGTTGTCCAGGAGAAAATC
TAGCTTATGTCATTCTAGGAAATGTTGTAGGGATGATGGTGCAGGGTTTTGAGTGGAGAAACGAAGGAGCGAAAGTTGAC
TTGGAAGAATCAATCAAAGGATTGACCTTGACCATGGCTCATCCTCCTAAGTTCACTCCTGTCGGTCGAACCTCAGACCC
TTTAAATCTTAATCAGCAGAGTTGA