Details for Lyrate rockcress Locus 16034251

Position : sca3 ( 5`- 805909 .. 803632 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477538 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034251

Protein [Map View]
MYGGEFDGNAAFAGGGFMPSQATTQAHDSSSSLKNRDVRTLLPLTLKQLSSASTTGESNFSIDGVDINTVAIVGRISRME
NRITQVEFVVDDGTGWVDCVRWCQERQETEEMEAVKLGMYVRLHGHLKIFQGKRSVNVFSIRPVTDFNEIVHHFTECMYV
HMYNTKLRGGSITQATTTPRPQMPYSTMPTPAKPYQTGPSNQFPNQFNDPMHGVKQTVLNYLNQPMHLVSEAGVHCDIIA
RDLRIPLPQVKDALEQLSNDGCIYSTMDETCFKSTANA*

DNA
ATGTACGGAGGCGAGTTTGACGGCAACGCTGCTTTCGCCGGCGGCGGTTTCATGCCTTCTCAGGCAACTACGCAAGCGCA
TGACTCCTCCTCGTCCCTCAAGAACCGCGATGTACGTACCTTGCTTCCCCTGACACTGAAGCAGTTGAGCAGTGCATCAA
CTACTGGTGAATCAAATTTCTCTATTGATGGCGTTGATATTAACACTGTTGCCATTGTTGGACGGATTTCTAGAATGGAG
AACAGAATCACTCAGGTCGAATTTGTTGTTGATGACGGTACAGGCTGGGTTGATTGTGTCAGATGGTGTCAAGAGCGTCA
AGAAACCGAAGAAATGGAAGCAGTCAAGCTGGGAATGTATGTTCGCTTACATGGACACCTGAAAATTTTTCAAGGGAAGC
GATCTGTGAATGTTTTCTCAATCAGGCCTGTCACTGACTTCAATGAGATTGTACACCACTTTACGGAGTGTATGTATGTC
CACATGTACAACACCAAGTTACGGGGTGGCTCTATTACTCAGGCTACTACTACTCCTAGGCCTCAAATGCCATATTCAAC
AATGCCAACCCCTGCAAAGCCATACCAAACCGGTCCATCTAATCAGTTCCCGAACCAATTCAATGATCCAATGCATGGTG
TAAAGCAGACGGTCTTGAATTACCTGAATCAACCTATGCACCTCGTATCTGAAGCTGGTGTTCACTGTGATATAATTGCG
CGTGACCTCAGGATTCCGCTGCCTCAAGTCAAGGATGCGTTAGAACAGCTCTCAAACGATGGTTGCATTTACTCGACTAT
GGACGAGACATGCTTCAAATCGACAGCTAACGCTTGA