Details for Lyrate rockcress Locus 16034250

Position : sca3 ( 5`- 7139788 .. 7138582 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16034250

Protein [Map View]
MAMSNLPRDLVEEVLSRLSVTSTRAVRSTCKKWNIISKDESFTTKHVAQANAAARESEFQVVMMMEYKLYLMSVNLHGIE
NNVDPSIEVKGKLISLNIADQIVYEIEIYNFNSDSWKALYGDRRFFVHGVSLKGNTYWFAREYVRYEGVQEVMNYRFGPR
LPLPFDIFIIDNVSLSSVREEQLVVLHHQWMKLRMEIWVSNKIEPNAVSWRKLLEVNMRPLPRYRFRLDHGSFFIDEKNK
VVVVLDKDEETETRNLVYFIGEDGYFKEVELGESRGKNGSPFVSSYVPSSVQVSNSQRRQLTIFD*

DNA
ATGGCTATGTCTAATCTTCCTAGGGATTTGGTAGAAGAGGTGCTCTCTAGGCTTTCGGTGACATCTACGAGAGCAGTGCG
ATCTACTTGCAAAAAATGGAACATTATATCCAAAGACGAGAGCTTTACAACGAAGCACGTTGCTCAAGCAAACGCAGCAG
CAAGGGAAAGTGAGTTTCAGGTGGTAATGATGATGGAATATAAGCTTTATTTAATGAGCGTCAATCTCCATGGCATTGAA
AACAATGTTGATCCATCTATAGAGGTTAAGGGTAAACTTATTAGCCTAAACATAGCTGATCAAATCGTTTATGAGATTGA
AATTTACAACTTTAACTCTGATTCATGGAAGGCGCTTTACGGGGATAGGCGCTTTTTTGTACATGGCGTGTCTCTCAAGG
GAAATACTTACTGGTTTGCTAGAGAGTATGTGAGGTATGAAGGTGTACAAGAAGTAATGAATTACAGATTTGGACCGCGA
CTTCCTCTGCCTTTTGACATTTTTATAATCGATAATGTGAGTCTCTCGAGTGTTAGAGAAGAGCAGCTTGTGGTGTTACA
TCACCAATGGATGAAATTGAGGATGGAGATATGGGTTAGTAATAAGATTGAGCCTAATGCAGTGTCGTGGAGAAAGTTGT
TAGAGGTTAATATGAGACCATTACCTCGATATCGTTTTCGTCTTGACCATGGGAGTTTCTTCATTGACGAGAAGAATAAG
GTCGTTGTGGTTCTGGATAAAGACGAAGAGACGGAAACCCGCAACTTAGTTTATTTCATTGGAGAGGATGGATATTTCAA
AGAAGTGGAACTGGGAGAATCTAGAGGCAAAAATGGTTCTCCATTTGTGAGCTCTTATGTTCCAAGTTCAGTGCAAGTTA
GCAACTCGCAGAGGAGGCAATTAACCATATTTGATTAA