Details for Lyrate rockcress Locus 16034225

Position : sca3 ( 5`- 612233 .. 614225 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477479 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034225

Protein [Map View]
MSRKRTENGSESAPVTSHVPVDRFGFLKQEHGNSSPERFSKSRITSSTDHDREERKVRKWRKMIGVGGSDWKHYVRRKPN
VVRRRIRKGIPDCLRGLVWQLISGSRDLLLMNPGVYEQLVIYETSASELDIIRDISRTFPSHVFFQKRHGPGQRSLYNVL
KAYSVYDRDVGYVQGMGFIAGLLLLYMSEEDAFWLLVALLKGAVHAPMEGLYHAGLPLVQQYLFQLESLVKELIPKLGEH
FTQEMITPSMYASQWFITVFSYSFPFPLALRIWDVFLSEGVKIVFKVSLALLKYCQDELVKLPFEKLIHALKTFPEDAMN
PDTLLPLAYPIKVSKRLEELKLEYEKNNAKPVQP*

DNA
ATGAGTAGAAAAAGAACCGAAAATGGCAGTGAATCAGCACCAGTCACTTCTCATGTTCCCGTGGATAGATTCGGGTTTCT
CAAGCAAGAACATGGCAATTCTTCGCCTGAGCGTTTTAGCAAGTCTAGAATTACATCATCCACTGACCATGACAGAGAGG
AGAGAAAGGTGAGAAAATGGAGGAAGATGATTGGGGTTGGAGGTAGTGATTGGAAGCATTATGTCAGGAGAAAACCTAAT
GTTGTCAGAAGGCGTATACGAAAAGGGATCCCGGATTGCTTAAGAGGTCTTGTTTGGCAGTTAATCTCAGGAAGTCGGGA
CCTTTTGCTAATGAATCCTGGTGTTTATGAGCAATTGGTGATTTATGAAACATCGGCATCAGAGCTTGATATCATTCGAG
ACATATCCCGTACTTTCCCATCACATGTTTTCTTTCAGAAGAGACATGGACCCGGGCAAAGATCGTTGTACAATGTCCTT
AAGGCGTACTCAGTTTATGACAGAGATGTTGGATATGTTCAGGGGATGGGGTTTATAGCGGGTTTGTTGCTTCTGTATAT
GAGCGAAGAAGACGCGTTCTGGTTATTAGTTGCATTACTAAAAGGAGCTGTTCATGCTCCAATGGAAGGATTGTATCACG
CAGGGCTTCCCCTTGTACAGCAATACCTGTTTCAGTTAGAAAGCTTGGTAAAAGAGCTAATTCCGAAGCTCGGAGAACAT
TTTACTCAAGAAATGATTACTCCAAGTATGTATGCAAGTCAATGGTTCATCACCGTCTTCTCTTATTCATTTCCTTTCCC
TTTGGCTCTACGGATATGGGATGTGTTTCTCTCTGAGGGTGTTAAAATCGTGTTCAAAGTGAGCTTAGCATTGCTGAAGT
ATTGCCAAGATGAGTTGGTAAAATTACCGTTTGAGAAACTAATACATGCTCTGAAAACTTTCCCGGAAGATGCAATGAAT
CCGGATACCTTGCTTCCATTGGCTTACCCTATCAAGGTATCAAAGCGTTTGGAAGAACTGAAACTGGAGTATGAGAAGAA
TAATGCCAAACCGGTTCAACCGTAG