Details for Lyrate rockcress Locus 16034220

Position : sca3 ( 5`- 1053506 .. 1053757 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_896345 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16034220

Protein [Map View]
MADATEKAEHDRIFKKFDANGDGKISAAELGDALKNLGSVTHEDIKRMMAEIDTDGDGYISYQEFSDFASANRGLMKDVA
KIF*

DNA
ATGGCTGATGCAACAGAAAAAGCTGAGCATGACCGTATTTTCAAGAAATTTGATGCTAATGGAGATGGAAAAATCTCTGC
GGCCGAGCTTGGAGATGCTCTGAAGAACCTTGGCTCGGTCACACACGAGGACATTAAGCGTATGATGGCCGAGATTGATA
CCGATGGCGATGGATACATCTCGTACCAAGAATTTTCTGATTTTGCAAGTGCCAATCGTGGTCTTATGAAAGACGTCGCC
AAGATTTTCTAA